BLASTX nr result
ID: Ophiopogon25_contig00053159
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00053159 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK74092.1| hypothetical protein RhiirC2_739519 [Rhizophagus ... 89 1e-20 dbj|GBC22276.1| hypothetical protein RIR_0930600 [Rhizophagus ir... 54 6e-07 dbj|GBC22275.1| hypothetical protein RIR_0930600 [Rhizophagus ir... 54 7e-07 >gb|PKK74092.1| hypothetical protein RhiirC2_739519 [Rhizophagus irregularis] Length = 57 Score = 89.0 bits (219), Expect = 1e-20 Identities = 44/49 (89%), Positives = 45/49 (91%) Frame = +2 Query: 182 M*RGSSIYYWTLAANAIFSSSPADIPSIPKKPLNTPMTNHMHVQLAVVN 328 M RGSSIYYWTLAA AIFSSSPADI SIPKK LNTPMTNHMH+QLAVVN Sbjct: 1 MQRGSSIYYWTLAAYAIFSSSPADILSIPKKLLNTPMTNHMHIQLAVVN 49 >dbj|GBC22276.1| hypothetical protein RIR_0930600 [Rhizophagus irregularis DAOM 181602] Length = 68 Score = 54.3 bits (129), Expect = 6e-07 Identities = 20/23 (86%), Positives = 23/23 (100%) Frame = -1 Query: 331 SVYHCQLDMHMICHRRIQRLFWD 263 ++YHCQLDMHMICHRRIQ+LFWD Sbjct: 46 NIYHCQLDMHMICHRRIQQLFWD 68 >dbj|GBC22275.1| hypothetical protein RIR_0930600 [Rhizophagus irregularis DAOM 181602] Length = 75 Score = 54.3 bits (129), Expect = 7e-07 Identities = 20/23 (86%), Positives = 23/23 (100%) Frame = -1 Query: 331 SVYHCQLDMHMICHRRIQRLFWD 263 ++YHCQLDMHMICHRRIQ+LFWD Sbjct: 53 NIYHCQLDMHMICHRRIQQLFWD 75