BLASTX nr result
ID: Ophiopogon25_contig00052884
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00052884 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC42788.1| hypothetical protein RIR_2592700 [Rhizophagus ir... 85 2e-16 >dbj|GBC42788.1| hypothetical protein RIR_2592700 [Rhizophagus irregularis DAOM 181602] Length = 353 Score = 85.1 bits (209), Expect = 2e-16 Identities = 47/122 (38%), Positives = 70/122 (57%), Gaps = 1/122 (0%) Frame = -2 Query: 365 PLQKRADPPKAVTSDPGKQPTTSQVPAKATDAPKSVSVAKTNPSTTASPIAKNDPSQYK- 189 P K PPK + P K P+T ++PAK+ S T +T K+DP Q Sbjct: 131 PNPKDQTPPKDPKNQPPKDPSTPKIPAKSPQKNDSKEADDTTDNTLPKD-DKDDPDQAAA 189 Query: 188 NSDSGSSQSVPTDPISTPAIIALASIGGAFIVVAGLFVFIRKRRRKAMANNIVATSAAAW 9 + +GS+ +V T P+S+ AI LA++GG F++V GLF F ++R+ M +IV++SA AW Sbjct: 190 QAQAGSTPTVNTGPLSSSAIGGLAAVGGVFVLVGGLFAFSQRRKNNEMTKSIVSSSAKAW 249 Query: 8 EQ 3 EQ Sbjct: 250 EQ 251