BLASTX nr result
ID: Ophiopogon25_contig00052663
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00052663 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC41632.1| Pre-mRNA-processing ATP-dependent RNA helicase P... 80 6e-15 >dbj|GBC41632.1| Pre-mRNA-processing ATP-dependent RNA helicase PRP5 [Rhizophagus irregularis DAOM 181602] Length = 400 Score = 80.5 bits (197), Expect = 6e-15 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = -3 Query: 364 KPALFQHPNYLQFWLAYFYYSSYYGLRLITTFQLNMGKYT 245 KPALFQHPNYLQFWLAYFYYSSYYGLR TFQLNMGKYT Sbjct: 364 KPALFQHPNYLQFWLAYFYYSSYYGLR---TFQLNMGKYT 400