BLASTX nr result
ID: Ophiopogon25_contig00051467
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00051467 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY49347.1| guanine nucleotide-binding protein, beta subunit ... 61 3e-08 gb|AOP03966.1| Ste4 [Rhizophagus irregularis] >gi|1064291114|gb|... 61 3e-08 emb|CCU69786.1| putative G protein beta subunit, partial [Rhizop... 56 3e-07 dbj|GBC21125.1| guanine nucleotide-binding protein subunit beta ... 55 7e-06 >gb|PKY49347.1| guanine nucleotide-binding protein, beta subunit [Rhizophagus irregularis] Length = 324 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 334 TLKEKIKMRKDSLADTSLRTMAAEIDPLPRIV 429 TLKEKIKMRKD+LADTSLRTMAAEI+PLPRIV Sbjct: 17 TLKEKIKMRKDTLADTSLRTMAAEIEPLPRIV 48 >gb|AOP03966.1| Ste4 [Rhizophagus irregularis] gb|AOP03967.1| Ste4 [Rhizophagus irregularis] gb|AOP03968.1| Ste4 [Rhizophagus irregularis] gb|AOP03969.1| Ste4 [Rhizophagus irregularis] gb|AOP03970.1| Ste4 [Rhizophagus irregularis] dbj|GBC21126.1| Guanine nucleotide-binding protein subunit beta [Rhizophagus irregularis DAOM 181602] gb|PKC06962.1| guanine nucleotide-binding protein, beta subunit [Rhizophagus irregularis] gb|PKC62154.1| guanine nucleotide-binding protein, beta subunit [Rhizophagus irregularis] gb|PKK69527.1| guanine nucleotide-binding protein, beta subunit [Rhizophagus irregularis] gb|PKY26561.1| guanine nucleotide-binding protein, beta subunit [Rhizophagus irregularis] gb|POG79048.1| WD40-repeat-containing domain protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 344 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 334 TLKEKIKMRKDSLADTSLRTMAAEIDPLPRIV 429 TLKEKIKMRKD+LADTSLRTMAAEI+PLPRIV Sbjct: 17 TLKEKIKMRKDTLADTSLRTMAAEIEPLPRIV 48 >emb|CCU69786.1| putative G protein beta subunit, partial [Rhizophagus irregularis] Length = 111 Score = 55.8 bits (133), Expect = 3e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 334 TLKEKIKMRKDSLADTSLRTMAAEIDPLPRIV 429 TLKEKIKMRKD+LADTS TMAAEI+PLPRIV Sbjct: 11 TLKEKIKMRKDTLADTSRITMAAEIEPLPRIV 42 >dbj|GBC21125.1| guanine nucleotide-binding protein subunit beta [Rhizophagus irregularis DAOM 181602] Length = 348 Score = 54.7 bits (130), Expect = 7e-06 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = +1 Query: 334 TLKEKIKMRKDSLADTS----LRTMAAEIDPLPRIV 429 TLKEKIKMRKD+LADTS +RTMAAEI+PLPRIV Sbjct: 17 TLKEKIKMRKDTLADTSQGLKMRTMAAEIEPLPRIV 52