BLASTX nr result
ID: Ophiopogon25_contig00051356
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00051356 (593 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY37777.1| hypothetical protein RhiirA4_390968 [Rhizophagus ... 65 3e-09 >gb|PKY37777.1| hypothetical protein RhiirA4_390968 [Rhizophagus irregularis] Length = 213 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = +1 Query: 457 MSLLLAAWSFYDLRKIFADCNVLKTMIESDKMSYIESLNSLEATL 591 MSLLL WSFYDLRK+F NVLK M+E+DK++Y+ESL +LEA L Sbjct: 1 MSLLLVTWSFYDLRKVFKYRNVLKMMVENDKINYVESLGTLEAIL 45