BLASTX nr result
ID: Ophiopogon25_contig00051261
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00051261 (534 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY44659.1| hypothetical protein RhiirA4_400177 [Rhizophagus ... 58 3e-08 gb|PKC15813.1| hypothetical protein RhiirA5_348612 [Rhizophagus ... 57 5e-08 >gb|PKY44659.1| hypothetical protein RhiirA4_400177 [Rhizophagus irregularis] Length = 59 Score = 57.8 bits (138), Expect = 3e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 412 VFNVSSLDSSIIEDVLGKPYIGPFSHKNL 498 V NVSSLDSSIIEDVLGKPYIGPFSHKN+ Sbjct: 5 VSNVSSLDSSIIEDVLGKPYIGPFSHKNI 33 >gb|PKC15813.1| hypothetical protein RhiirA5_348612 [Rhizophagus irregularis] gb|PKC71353.1| hypothetical protein RhiirA1_413322 [Rhizophagus irregularis] gb|PKK74858.1| hypothetical protein RhiirC2_737869 [Rhizophagus irregularis] gb|PKY16590.1| hypothetical protein RhiirB3_403064 [Rhizophagus irregularis] Length = 59 Score = 57.4 bits (137), Expect = 5e-08 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 3/33 (9%) Frame = +1 Query: 409 MVFNVS---SLDSSIIEDVLGKPYIGPFSHKNL 498 MVFNVS SLDSSIIEDVLGKPYIGPFSHKN+ Sbjct: 1 MVFNVSHVSSLDSSIIEDVLGKPYIGPFSHKNI 33