BLASTX nr result
ID: Ophiopogon25_contig00051159
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00051159 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PRQ15612.1| hypothetical protein RchiOBHm_MTg0498411 (mitocho... 53 3e-06 ref|YP_009049820.1| hypothetical protein (mitochondrion) [Capsic... 52 4e-06 >gb|PRQ15612.1| hypothetical protein RchiOBHm_MTg0498411 (mitochondrion) [Rosa chinensis] Length = 122 Score = 53.1 bits (126), Expect = 3e-06 Identities = 26/41 (63%), Positives = 28/41 (68%) Frame = -3 Query: 414 C*ILTYPKALKPNSWWIPGDKVKVLIPASLPRTSRCSSQPT 292 C I+T+ ALKPN WWIPGDK K L P LP T RCSS T Sbjct: 32 CWIVTHHTALKPNLWWIPGDKAKALDP--LPHTLRCSSPRT 70 >ref|YP_009049820.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|AIG89896.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|AIG90178.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|PHT62422.1| hypothetical protein T459_33727 [Capsicum annuum] gb|ATW72821.1| orf102 (mitochondrion) [Solanum commersonii] gb|AUS83342.1| hypothetical protein (mitochondrion) [Solanum tuberosum] gb|AUS83349.1| hypothetical protein (mitochondrion) [Solanum tuberosum] gb|AUS83389.1| hypothetical protein (mitochondrion) [Solanum tuberosum] gb|AUS83411.1| hypothetical protein (mitochondrion) [Solanum tuberosum] gb|AUS83454.1| hypothetical protein (mitochondrion) [Solanum tuberosum] Length = 102 Score = 52.4 bits (124), Expect = 4e-06 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = -3 Query: 423 SKLC*ILTYPKALKPNSWWIPGDKVKVLIPASLPRTSRCSS 301 S+ C I+T+ ALKPN WWIPGDKVK P LP T RCSS Sbjct: 29 SEPCWIVTHHTALKPNLWWIPGDKVKTQHP--LPHTLRCSS 67