BLASTX nr result
ID: Ophiopogon25_contig00051158
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00051158 (383 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC27218.1| hypothetical protein RIR_1336800 [Rhizophagus ir... 61 4e-08 >dbj|GBC27218.1| hypothetical protein RIR_1336800 [Rhizophagus irregularis DAOM 181602] gb|POG81481.1| hypothetical protein GLOIN_2v1763409 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 775 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/54 (53%), Positives = 40/54 (74%) Frame = -3 Query: 261 EMSKQIPKVESPSLYVIPSLNTQK*VLEILNKIEYCKESGTAD*VNHGRVPWVL 100 + ++Q+ + ++Y+IPSLNTQ+ VLE+LNKIE C+E GTA VN R PWVL Sbjct: 554 DKNRQLSREIRNAMYLIPSLNTQEEVLEVLNKIESCEEPGTAAWVNDKRTPWVL 607