BLASTX 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Ophiopogon25_contig00051154
         (685 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           149,584,005 sequences; 54,822,741,787 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

dbj|GBC41542.1| hypothetical protein RIR_2491300 [Rhizophagus ir...    55   6e-07

>dbj|GBC41542.1| hypothetical protein RIR_2491300 [Rhizophagus irregularis DAOM
           181602]
          Length = 92

 Score = 55.5 bits (132), Expect(2) = 6e-07
 Identities = 34/69 (49%), Positives = 36/69 (52%)
 Frame = +3

Query: 84  QDIQPSLNCPFYKYMNFSRTSGLRSRLNVL*IDITPFKGLS*KVPRHGFLML*FSRLIIN 263
           Q IQPSL CP YKYMNFSR +GLRSRLN                         FSRLIIN
Sbjct: 46  QAIQPSLYCPIYKYMNFSRITGLRSRLN-------------------------FSRLIIN 80

Query: 264 SPH*RLFIF 290
           SP  + F F
Sbjct: 81  SPPLKTFNF 89



 Score = 26.6 bits (57), Expect(2) = 6e-07
 Identities = 10/11 (90%), Positives = 10/11 (90%)
 Frame = +2

Query: 266 PPLKTFYFYYR 298
           PPLKTF FYYR
Sbjct: 82  PPLKTFNFYYR 92