BLASTX nr result
ID: Ophiopogon25_contig00051042
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00051042 (657 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY43452.1| hypothetical protein RhiirA4_398802, partial [Rhi... 139 2e-39 gb|EXX77421.1| hypothetical protein RirG_023980 [Rhizophagus irr... 134 1e-37 gb|EXX50962.1| hypothetical protein RirG_265900 [Rhizophagus irr... 63 8e-10 gb|EXX58973.1| hypothetical protein RirG_193000 [Rhizophagus irr... 55 1e-06 >gb|PKY43452.1| hypothetical protein RhiirA4_398802, partial [Rhizophagus irregularis] Length = 72 Score = 139 bits (351), Expect = 2e-39 Identities = 68/72 (94%), Positives = 70/72 (97%) Frame = -3 Query: 448 LLRMFSTINNYFSLMKYQSDISTSKSLEPWEKALFNSCIIVGITLLAYTTFAQSNNMFLT 269 LLRM +TINNYFSLMKYQSDISTSKSLEPWEKALFNSCIIVGITLLAYTTFAQSNNMFLT Sbjct: 1 LLRMLTTINNYFSLMKYQSDISTSKSLEPWEKALFNSCIIVGITLLAYTTFAQSNNMFLT 60 Query: 268 SIDTDFHSSLYL 233 + DTDFHSSLYL Sbjct: 61 NFDTDFHSSLYL 72 >gb|EXX77421.1| hypothetical protein RirG_023980 [Rhizophagus irregularis DAOM 197198w] dbj|GBC12048.1| hypothetical protein RIR_0099800 [Rhizophagus irregularis DAOM 181602] gb|PKC11728.1| hypothetical protein RhiirA5_353853 [Rhizophagus irregularis] gb|PKC71893.1| hypothetical protein RhiirA1_412536 [Rhizophagus irregularis] gb|PKK76096.1| hypothetical protein RhiirC2_735022 [Rhizophagus irregularis] gb|PKY14514.1| hypothetical protein RhiirB3_400408 [Rhizophagus irregularis] Length = 69 Score = 134 bits (338), Expect = 1e-37 Identities = 65/69 (94%), Positives = 67/69 (97%) Frame = -3 Query: 439 MFSTINNYFSLMKYQSDISTSKSLEPWEKALFNSCIIVGITLLAYTTFAQSNNMFLTSID 260 M +TINNYFSLMKYQSDISTSKSLEPWEKALFNSCIIVGITLLAYTTFAQSNNMFLT+ D Sbjct: 1 MLTTINNYFSLMKYQSDISTSKSLEPWEKALFNSCIIVGITLLAYTTFAQSNNMFLTNFD 60 Query: 259 TDFHSSLYL 233 TDFHSSLYL Sbjct: 61 TDFHSSLYL 69 >gb|EXX50962.1| hypothetical protein RirG_265900 [Rhizophagus irregularis DAOM 197198w] dbj|GBC42185.1| hypothetical protein RIR_2544100 [Rhizophagus irregularis DAOM 181602] gb|PKC69805.1| hypothetical protein RhiirA1_533190 [Rhizophagus irregularis] gb|PKK62187.1| hypothetical protein RhiirC2_759862 [Rhizophagus irregularis] gb|PKY23761.1| hypothetical protein RhiirB3_526747 [Rhizophagus irregularis] gb|PKY49976.1| hypothetical protein RhiirA4_545627 [Rhizophagus irregularis] gb|POG77523.1| hypothetical protein GLOIN_2v1547607 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 69 Score = 63.2 bits (152), Expect = 8e-10 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 3/68 (4%) Frame = -3 Query: 439 MFSTINNYFSLMKYQSDISTSKSLEPWEKALFNSCIIVGITLLAYTTFA---QSNNMFLT 269 M S+I NYF++ YQS++STS ++EPWE+ LFNS I + ITL YT FA + N F Sbjct: 1 MISSIRNYFTVKNYQSEVSTS-TIEPWERVLFNSVIAMSITLFMYTAFANFPEQNFNFHH 59 Query: 268 SIDTDFHS 245 SI D+HS Sbjct: 60 SIG-DYHS 66 >gb|EXX58973.1| hypothetical protein RirG_193000 [Rhizophagus irregularis DAOM 197198w] dbj|GBC25089.1| serine palmitoyltransferase small subunit b [Rhizophagus irregularis DAOM 181602] gb|PKC14158.1| hypothetical protein RhiirA5_495591 [Rhizophagus irregularis] gb|PKC69158.1| hypothetical protein RhiirA1_377716 [Rhizophagus irregularis] gb|PKK78664.1| hypothetical protein RhiirC2_729084 [Rhizophagus irregularis] gb|PKY15826.1| hypothetical protein RhiirB3_520711 [Rhizophagus irregularis] gb|PKY41003.1| hypothetical protein RhiirA4_539271 [Rhizophagus irregularis] gb|POG75999.1| hypothetical protein GLOIN_2v1769612 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 74 Score = 54.7 bits (130), Expect = 1e-06 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 1/49 (2%) Frame = -3 Query: 439 MFSTINNYFSLMKYQSDISTSK-SLEPWEKALFNSCIIVGITLLAYTTF 296 M I NY +L YQ +++T+ LEPWEKALFNS +IV + L YTTF Sbjct: 1 MLKAIRNYLALKNYQYEVTTALYMLEPWEKALFNSIVIVFLALFTYTTF 49