BLASTX nr result
ID: Ophiopogon25_contig00051002
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00051002 (628 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC32368.1| hypothetical protein RIR_1749800 [Rhizophagus ir... 79 5e-16 >dbj|GBC32368.1| hypothetical protein RIR_1749800 [Rhizophagus irregularis DAOM 181602] Length = 77 Score = 79.3 bits (194), Expect = 5e-16 Identities = 40/46 (86%), Positives = 41/46 (89%) Frame = +3 Query: 285 MYSRTINLIDAEKVIMPPCIKCPLILVEKISSEYDRLRVANSVGMK 422 MYSRTINLIDAEKV M PCIKCPLILV+ ISSEYDRLRVANSV K Sbjct: 1 MYSRTINLIDAEKVTMLPCIKCPLILVKNISSEYDRLRVANSVVKK 46