BLASTX nr result
ID: Ophiopogon25_contig00050773
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00050773 (566 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK73720.1| hypothetical protein RhiirC2_740298 [Rhizophagus ... 91 8e-19 gb|EXX65140.1| hypothetical protein RirG_136130 [Rhizophagus irr... 91 8e-19 >gb|PKK73720.1| hypothetical protein RhiirC2_740298 [Rhizophagus irregularis] Length = 242 Score = 90.5 bits (223), Expect = 8e-19 Identities = 43/55 (78%), Positives = 44/55 (80%) Frame = +3 Query: 402 MFTKPNKKNVQQYEDNYXXXXXXXXXXLTSEAKIDEAKRKFILECFERFKDAEEY 566 MFTKPNKKNVQQYEDNY LT EAK+DEAKRKFILECFERFKDAEEY Sbjct: 1 MFTKPNKKNVQQYEDNYKKAFFTFFKFLTGEAKVDEAKRKFILECFERFKDAEEY 55 >gb|EXX65140.1| hypothetical protein RirG_136130 [Rhizophagus irregularis DAOM 197198w] dbj|GBC53258.1| hypothetical protein RIR_3448900 [Rhizophagus irregularis DAOM 181602] gb|PKC13554.1| hypothetical protein RhiirA5_351489 [Rhizophagus irregularis] gb|PKC68698.1| hypothetical protein RhiirA1_416638 [Rhizophagus irregularis] gb|PKY16678.1| hypothetical protein RhiirB3_403171 [Rhizophagus irregularis] gb|PKY44976.1| hypothetical protein RhiirA4_400530 [Rhizophagus irregularis] gb|POG59151.1| hypothetical protein GLOIN_2v1724691 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 242 Score = 90.5 bits (223), Expect = 8e-19 Identities = 43/55 (78%), Positives = 44/55 (80%) Frame = +3 Query: 402 MFTKPNKKNVQQYEDNYXXXXXXXXXXLTSEAKIDEAKRKFILECFERFKDAEEY 566 MFTKPNKKNVQQYEDNY LT EAK+DEAKRKFILECFERFKDAEEY Sbjct: 1 MFTKPNKKNVQQYEDNYKKAFFTFFKFLTGEAKVDEAKRKFILECFERFKDAEEY 55