BLASTX nr result
ID: Ophiopogon25_contig00050587
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00050587 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC66458.1| Ssu72-like protein, partial [Rhizophagus irregula... 80 3e-16 gb|EXX51010.1| Ssu72p [Rhizophagus irregularis DAOM 197198w] >gi... 80 6e-16 >gb|PKC66458.1| Ssu72-like protein, partial [Rhizophagus irregularis] gb|PKY26518.1| Ssu72-like protein, partial [Rhizophagus irregularis] Length = 171 Score = 80.1 bits (196), Expect = 3e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 401 QMIDNEQVTDLDEAIPGILQEWQEKYKYEILHSIAYF 291 QMIDNEQVTDLDEAIPGILQEWQEKYKYEILHSIAYF Sbjct: 135 QMIDNEQVTDLDEAIPGILQEWQEKYKYEILHSIAYF 171 >gb|EXX51010.1| Ssu72p [Rhizophagus irregularis DAOM 197198w] dbj|GBC34302.1| RNA polymerase II subunit A C-terminal domain phosphatase SSU72 [Rhizophagus irregularis DAOM 181602] gb|PKC09355.1| Ssu72-like protein [Rhizophagus irregularis] gb|PKK76816.1| Ssu72-like protein [Rhizophagus irregularis] gb|PKY46245.1| Ssu72-like protein [Rhizophagus irregularis] gb|POG67538.1| RNA polymerase II subunit A [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 196 Score = 80.1 bits (196), Expect = 6e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 401 QMIDNEQVTDLDEAIPGILQEWQEKYKYEILHSIAYF 291 QMIDNEQVTDLDEAIPGILQEWQEKYKYEILHSIAYF Sbjct: 160 QMIDNEQVTDLDEAIPGILQEWQEKYKYEILHSIAYF 196