BLASTX nr result
ID: Ophiopogon25_contig00050522
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00050522 (403 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC59987.1| hypothetical protein RhiirA1_540144 [Rhizophagus ... 82 2e-17 dbj|GBC30790.1| hypothetical protein RIR_1624300 [Rhizophagus ir... 80 1e-15 dbj|GBC30791.1| hypothetical protein RIR_1624300 [Rhizophagus ir... 80 2e-15 gb|PKY53545.1| hypothetical protein RhiirA4_471820, partial [Rhi... 77 1e-14 gb|PKK59953.1| hypothetical protein RhiirC2_871103 [Rhizophagus ... 74 1e-13 dbj|GBC39538.1| hypothetical protein RIR_2326600 [Rhizophagus ir... 72 3e-12 gb|POG60079.1| hypothetical protein GLOIN_2v1788354 [Rhizophagus... 65 1e-11 gb|PKY36320.1| hypothetical protein RhiirB3_458652 [Rhizophagus ... 63 1e-10 gb|PKK60436.1| hypothetical protein RhiirC2_856851 [Rhizophagus ... 63 1e-09 gb|PKY51314.1| hypothetical protein RhiirA4_468255 [Rhizophagus ... 60 5e-09 gb|PKK63775.1| hypothetical protein RhiirC2_788429 [Rhizophagus ... 45 1e-07 gb|PKC67442.1| hypothetical protein RhiirA1_393719 [Rhizophagus ... 57 2e-07 >gb|PKC59987.1| hypothetical protein RhiirA1_540144 [Rhizophagus irregularis] Length = 128 Score = 81.6 bits (200), Expect(3) = 2e-17 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = +3 Query: 3 DFLVGFLNVGRHLASVFFFVGWYLAVDQHFGMNRKPAWSRNRTLK 137 DFLVGFL VGRHLASVFFFVGWYLAVDQH GMNR WS+NRTLK Sbjct: 10 DFLVGFLGVGRHLASVFFFVGWYLAVDQHLGMNRS-WWSQNRTLK 53 Score = 27.7 bits (60), Expect(3) = 2e-17 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 Query: 269 GCCLRTHGLNGGVRFF 316 G LRTHGLNG ++FF Sbjct: 113 GSGLRTHGLNGALQFF 128 Score = 26.9 bits (58), Expect(3) = 2e-17 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 8/28 (28%) Frame = +1 Query: 145 EDASLNTK--------LDFKSAGLDYKE 204 +DA LNT DFKSA LDYKE Sbjct: 77 KDAGLNTNQTLRTHRSTDFKSASLDYKE 104 >dbj|GBC30790.1| hypothetical protein RIR_1624300 [Rhizophagus irregularis DAOM 181602] Length = 238 Score = 80.1 bits (196), Expect = 1e-15 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = +3 Query: 3 DFLVGFLNVGRHLASVFFFVGWYLAVDQHFGMNRKPAWSRNRTLK 137 DFLVGFL VGRHLASVFFFVGWYLAVDQH GMN+ WS+NRTLK Sbjct: 51 DFLVGFLGVGRHLASVFFFVGWYLAVDQHLGMNQS-WWSQNRTLK 94 >dbj|GBC30791.1| hypothetical protein RIR_1624300 [Rhizophagus irregularis DAOM 181602] Length = 284 Score = 80.1 bits (196), Expect = 2e-15 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = +3 Query: 3 DFLVGFLNVGRHLASVFFFVGWYLAVDQHFGMNRKPAWSRNRTLK 137 DFLVGFL VGRHLASVFFFVGWYLAVDQH GMN+ WS+NRTLK Sbjct: 97 DFLVGFLGVGRHLASVFFFVGWYLAVDQHLGMNQS-WWSQNRTLK 140 >gb|PKY53545.1| hypothetical protein RhiirA4_471820, partial [Rhizophagus irregularis] Length = 214 Score = 77.0 bits (188), Expect = 1e-14 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +3 Query: 9 LVGFLNVGRHLASVFFFVGWYLAVDQHFGMNRKPAWSRNRTLK 137 LVGFLNVGRHLASVFFFVGWYLAVDQ+ GMNR WS+NRTLK Sbjct: 23 LVGFLNVGRHLASVFFFVGWYLAVDQYLGMNRS-WWSQNRTLK 64 >gb|PKK59953.1| hypothetical protein RhiirC2_871103 [Rhizophagus irregularis] Length = 198 Score = 73.9 bits (180), Expect = 1e-13 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +3 Query: 3 DFLVGFLNVGRHLASVFFFVGWYLAVDQHFGMNRKP 110 DFLVGFL VGRHLASVFFFVGWYLAVDQH GMNR P Sbjct: 128 DFLVGFLGVGRHLASVFFFVGWYLAVDQHLGMNRHP 163 >dbj|GBC39538.1| hypothetical protein RIR_2326600 [Rhizophagus irregularis DAOM 181602] Length = 268 Score = 71.6 bits (174), Expect = 3e-12 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = +3 Query: 3 DFLVGFLNVGRHLASVFFFVGWYLAVDQHFGMNRKPAWSRNRTLKRV 143 DFLVGFL VGRHLASVFFFVGWYLAV+QH GMNR +W+ R + + Sbjct: 58 DFLVGFLGVGRHLASVFFFVGWYLAVNQHLGMNR--SWTCRRNISDI 102 >gb|POG60079.1| hypothetical protein GLOIN_2v1788354 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 54 Score = 65.5 bits (158), Expect = 1e-11 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 DFLVGFLNVGRHLASVFFFVGWYLAVDQHFGMNRKPAW 116 D LVGFL+ G HLA +FFFV WYLAVD+H G+NR+PAW Sbjct: 12 DILVGFLDAGHHLALLFFFVEWYLAVDKHLGINREPAW 49 >gb|PKY36320.1| hypothetical protein RhiirB3_458652 [Rhizophagus irregularis] Length = 61 Score = 62.8 bits (151), Expect = 1e-10 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 3 DFLVGFLNVGRHLASVFFFVGWYLAVDQHFGMNR 104 DFLVGFL++GR LA V FFVGWYLAVDQH GMNR Sbjct: 28 DFLVGFLDIGRLLALVIFFVGWYLAVDQHLGMNR 61 >gb|PKK60436.1| hypothetical protein RhiirC2_856851 [Rhizophagus irregularis] Length = 180 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +3 Query: 3 DFLVGFLNVGRHLASVFFFVGWYLAVDQHFGMNRKPAWSRNR 128 D LVGFL+ GRHLA VFFFV WYLAVDQH G+NR+ A +R Sbjct: 12 DILVGFLDAGRHLALVFFFVEWYLAVDQHLGINREAAVFEHR 53 >gb|PKY51314.1| hypothetical protein RhiirA4_468255 [Rhizophagus irregularis] Length = 94 Score = 59.7 bits (143), Expect = 5e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 3 DFLVGFLNVGRHLASVFFFVGWYLAVDQHFGMN 101 DFLVGFL+VGRHLAS+FFFVG YLAVDQ G+N Sbjct: 12 DFLVGFLDVGRHLASIFFFVGRYLAVDQRLGIN 44 >gb|PKK63775.1| hypothetical protein RhiirC2_788429 [Rhizophagus irregularis] Length = 135 Score = 45.4 bits (106), Expect(2) = 1e-07 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +3 Query: 3 DFLVGFLNVGRHLASVFFFVGWYLA 77 DFLVGFL++GR LA V FFVGWYLA Sbjct: 35 DFLVGFLDIGRLLALVIFFVGWYLA 59 Score = 38.1 bits (87), Expect(2) = 1e-07 Identities = 29/71 (40%), Positives = 34/71 (47%), Gaps = 2/71 (2%) Frame = +2 Query: 113 LVTKPDFKTCRRTP--A*TQNWTLRAPAWTIRKIW*GSFSTKXXXXXXXXXXXVGCCLRT 286 +VTK D KT RRTP + N TLR R+ ++ G LRT Sbjct: 62 VVTKLDLKTYRRTPDASLDTNQTLRT-----RRSMDFKSASLDYKEGNSAVGSSGSGLRT 116 Query: 287 HGLNGGVRFFG 319 HGLNGGV FFG Sbjct: 117 HGLNGGVSFFG 127 >gb|PKC67442.1| hypothetical protein RhiirA1_393719 [Rhizophagus irregularis] Length = 140 Score = 56.6 bits (135), Expect = 2e-07 Identities = 37/88 (42%), Positives = 42/88 (47%) Frame = +2 Query: 56 FCRMVPCCGSTFWNESEASLVTKPDFKTCRRTPA*TQNWTLRAPAWTIRKIW*GSFSTKX 235 FCRMVPCC ST WNESE +VTK DFK + + + + ST Sbjct: 51 FCRMVPCCRSTSWNESEL-VVTKLDFKDVYEDSSLNTKLDFKDSSLDTNQTLRTRRSTDF 109 Query: 236 XXXXXXXXXXVGCCLRTHGLNGGVRFFG 319 G LRTHGLNGGV FFG Sbjct: 110 KAVGSS-----GSGLRTHGLNGGVSFFG 132