BLASTX nr result
ID: Ophiopogon25_contig00050515
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00050515 (516 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275339.1| uncharacterized protein DDB_G0271670-like is... 62 4e-08 ref|XP_020275338.1| uncharacterized protein DDB_G0271670-like is... 62 4e-08 >ref|XP_020275339.1| uncharacterized protein DDB_G0271670-like isoform X2 [Asparagus officinalis] Length = 611 Score = 62.4 bits (150), Expect = 4e-08 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +3 Query: 348 KVSTQQPHIRKEISANLLPSRPNAKASAVTRVLSDPSNTDHVRSSINSITGSKSFK 515 +V+T QP IRKE S NLL +RP A A TRVLS+ SN DH RSSIN+ TG + K Sbjct: 399 RVATHQPRIRKESSVNLLHARPIANVPAGTRVLSESSNKDHPRSSINNNTGLRGSK 454 >ref|XP_020275338.1| uncharacterized protein DDB_G0271670-like isoform X1 [Asparagus officinalis] gb|ONK62421.1| uncharacterized protein A4U43_C07F3690 [Asparagus officinalis] Length = 625 Score = 62.4 bits (150), Expect = 4e-08 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +3 Query: 348 KVSTQQPHIRKEISANLLPSRPNAKASAVTRVLSDPSNTDHVRSSINSITGSKSFK 515 +V+T QP IRKE S NLL +RP A A TRVLS+ SN DH RSSIN+ TG + K Sbjct: 413 RVATHQPRIRKESSVNLLHARPIANVPAGTRVLSESSNKDHPRSSINNNTGLRGSK 468