BLASTX nr result
ID: Ophiopogon25_contig00050480
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00050480 (689 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK76306.1| hypothetical protein RhiirC2_734693 [Rhizophagus ... 97 1e-20 dbj|GBC26489.1| hypothetical protein RIR_1274700 [Rhizophagus ir... 97 1e-20 gb|PKC13875.1| hypothetical protein RhiirA5_351090 [Rhizophagus ... 90 5e-18 gb|EXX68575.1| hypothetical protein RirG_103950 [Rhizophagus irr... 90 5e-18 gb|PKK67800.1| hypothetical protein RhiirC2_751216 [Rhizophagus ... 90 5e-18 gb|PKY39140.1| hypothetical protein RhiirA4_393024 [Rhizophagus ... 89 1e-17 gb|PKY39634.1| hypothetical protein RhiirA4_415193 [Rhizophagus ... 70 2e-11 >gb|PKK76306.1| hypothetical protein RhiirC2_734693 [Rhizophagus irregularis] Length = 268 Score = 97.4 bits (241), Expect = 1e-20 Identities = 46/70 (65%), Positives = 55/70 (78%), Gaps = 3/70 (4%) Frame = -1 Query: 317 WTVKRNHHTYLYVEPYEPVVHGTYGVDQTTSWRVIWSITSSVR---DFFAEVMNGGRGFG 147 W+V+R+ +TY YVEPYE VVHGT+GV+Q T W I+++V DF AEVMNGGRGFG Sbjct: 204 WSVRRSQYTYAYVEPYEAVVHGTFGVEQNT-----WGISTAVNLIHDFIAEVMNGGRGFG 258 Query: 146 SPSYDGFVPI 117 SPSYDGFVPI Sbjct: 259 SPSYDGFVPI 268 >dbj|GBC26489.1| hypothetical protein RIR_1274700 [Rhizophagus irregularis DAOM 181602] gb|PKC17584.1| hypothetical protein RhiirA5_346056 [Rhizophagus irregularis] gb|PKC73662.1| hypothetical protein RhiirA1_410261 [Rhizophagus irregularis] gb|PKY19574.1| hypothetical protein RhiirB3_407024 [Rhizophagus irregularis] gb|POG70997.1| hypothetical protein GLOIN_2v1610574 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 268 Score = 97.4 bits (241), Expect = 1e-20 Identities = 46/70 (65%), Positives = 55/70 (78%), Gaps = 3/70 (4%) Frame = -1 Query: 317 WTVKRNHHTYLYVEPYEPVVHGTYGVDQTTSWRVIWSITSSVR---DFFAEVMNGGRGFG 147 W+V+R+ +TY YVEPYE VVHGT+GV+Q T W I+++V DF AEVMNGGRGFG Sbjct: 204 WSVRRSQYTYAYVEPYEAVVHGTFGVEQNT-----WGISTAVNLIHDFIAEVMNGGRGFG 258 Query: 146 SPSYDGFVPI 117 SPSYDGFVPI Sbjct: 259 SPSYDGFVPI 268 >gb|PKC13875.1| hypothetical protein RhiirA5_351090 [Rhizophagus irregularis] gb|PKC63706.1| hypothetical protein RhiirA1_422455 [Rhizophagus irregularis] gb|PKY25097.1| hypothetical protein RhiirB3_413723 [Rhizophagus irregularis] Length = 247 Score = 89.7 bits (221), Expect = 5e-18 Identities = 40/67 (59%), Positives = 51/67 (76%) Frame = -1 Query: 317 WTVKRNHHTYLYVEPYEPVVHGTYGVDQTTSWRVIWSITSSVRDFFAEVMNGGRGFGSPS 138 W KR +TY+Y+EPYE VVHGTYGV+ TTSW + SI ++ DFF+E+ +GGR F SP+ Sbjct: 182 WKFKRAQYTYVYIEPYEAVVHGTYGVE-TTSWTYLSSIMDNMFDFFSEMKHGGRSFSSPN 240 Query: 137 YDGFVPI 117 YDG VPI Sbjct: 241 YDGLVPI 247 >gb|EXX68575.1| hypothetical protein RirG_103950 [Rhizophagus irregularis DAOM 197198w] dbj|GBC30377.1| hypothetical protein RIR_1590900 [Rhizophagus irregularis DAOM 181602] gb|POG71441.1| hypothetical protein GLOIN_2v1606322 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 247 Score = 89.7 bits (221), Expect = 5e-18 Identities = 40/67 (59%), Positives = 51/67 (76%) Frame = -1 Query: 317 WTVKRNHHTYLYVEPYEPVVHGTYGVDQTTSWRVIWSITSSVRDFFAEVMNGGRGFGSPS 138 W KR +TY+Y+EPYE VVHGTYGV+ TTSW + SI ++ DFF+E+ +GGR F SP+ Sbjct: 182 WKFKRAQYTYVYIEPYEAVVHGTYGVE-TTSWTYLSSIMDNMFDFFSEMKHGGRSFSSPN 240 Query: 137 YDGFVPI 117 YDG VPI Sbjct: 241 YDGLVPI 247 >gb|PKK67800.1| hypothetical protein RhiirC2_751216 [Rhizophagus irregularis] Length = 248 Score = 89.7 bits (221), Expect = 5e-18 Identities = 40/67 (59%), Positives = 51/67 (76%) Frame = -1 Query: 317 WTVKRNHHTYLYVEPYEPVVHGTYGVDQTTSWRVIWSITSSVRDFFAEVMNGGRGFGSPS 138 W KR +TY+Y+EPYE VVHGTYGV+ TTSW + SI ++ DFF+E+ +GGR F SP+ Sbjct: 183 WKFKRAQYTYVYIEPYEAVVHGTYGVE-TTSWTYLSSIMDNMFDFFSEMKHGGRSFSSPN 241 Query: 137 YDGFVPI 117 YDG VPI Sbjct: 242 YDGLVPI 248 >gb|PKY39140.1| hypothetical protein RhiirA4_393024 [Rhizophagus irregularis] Length = 248 Score = 88.6 bits (218), Expect = 1e-17 Identities = 39/67 (58%), Positives = 51/67 (76%) Frame = -1 Query: 317 WTVKRNHHTYLYVEPYEPVVHGTYGVDQTTSWRVIWSITSSVRDFFAEVMNGGRGFGSPS 138 W KR +TY+Y+EPYE VVHGTYGV+ TTSW + S+ ++ DFF+E+ +GGR F SP+ Sbjct: 183 WKFKRAQYTYVYIEPYEAVVHGTYGVE-TTSWTYLSSMMDNMFDFFSEMKHGGRSFSSPN 241 Query: 137 YDGFVPI 117 YDG VPI Sbjct: 242 YDGLVPI 248 >gb|PKY39634.1| hypothetical protein RhiirA4_415193 [Rhizophagus irregularis] Length = 179 Score = 70.5 bits (171), Expect = 2e-11 Identities = 35/54 (64%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = -1 Query: 269 EPVVHGTYGVDQTTSWRVIWSITSSVR---DFFAEVMNGGRGFGSPSYDGFVPI 117 + VVHGT+GV+Q T W I+++V DF AEVMNGGRGFGSPSYDGFVPI Sbjct: 131 QAVVHGTFGVEQNT-----WGISTAVNLIHDFIAEVMNGGRGFGSPSYDGFVPI 179