BLASTX nr result
ID: Ophiopogon25_contig00050312
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00050312 (816 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC74163.1| hypothetical protein RhiirA1_450324 [Rhizophagus ... 57 2e-06 gb|PKY40596.1| hypothetical protein RhiirA4_454008 [Rhizophagus ... 57 3e-06 dbj|GBC50427.1| hypothetical protein: PROVISIONAL [Rhizophagus i... 57 4e-06 >gb|PKC74163.1| hypothetical protein RhiirA1_450324 [Rhizophagus irregularis] Length = 173 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/51 (49%), Positives = 38/51 (74%) Frame = +3 Query: 288 FSGHINSQRTIKKLLLPFLYNLHVDVYKSI*KTRNALFKQWKLADGISKNS 440 F I S+ IK+LLL F+++LHV++Y +I KTRN+ FK+WK+ + ISK + Sbjct: 60 FQAAIRSKERIKRLLLSFVHDLHVEIYNTIWKTRNSKFKEWKIFNNISKKT 110 >gb|PKY40596.1| hypothetical protein RhiirA4_454008 [Rhizophagus irregularis] Length = 176 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/61 (45%), Positives = 43/61 (70%) Frame = +3 Query: 309 QRTIKKLLLPFLYNLHVDVYKSI*KTRNALFKQWKLADGISKNSLNRINVHIRRVTSQRI 488 ++ IKKLLL FL++LH D+Y+S+ KTR+A +KQ+K +GI+K+S + H R+ Q Sbjct: 45 KKMIKKLLLSFLFDLHRDIYESLWKTRSAKWKQYKKDNGITKSSFTKRPTHQRKRRRQNN 104 Query: 489 Y 491 Y Sbjct: 105 Y 105 >dbj|GBC50427.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 232 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/51 (49%), Positives = 38/51 (74%) Frame = +3 Query: 288 FSGHINSQRTIKKLLLPFLYNLHVDVYKSI*KTRNALFKQWKLADGISKNS 440 F I S+ IK+LLL F+++LHV++Y +I KTRN+ FK+WK+ + ISK + Sbjct: 119 FQAAIRSKERIKRLLLSFVHDLHVEIYNTIWKTRNSKFKEWKIFNNISKKT 169