BLASTX nr result
ID: Ophiopogon25_contig00049484
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00049484 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC44274.1| hypothetical protein RIR_2707800 [Rhizophagus ir... 136 1e-39 >dbj|GBC44274.1| hypothetical protein RIR_2707800 [Rhizophagus irregularis DAOM 181602] gb|PKC70570.1| hypothetical protein RhiirA1_98934 [Rhizophagus irregularis] gb|PKY17275.1| hypothetical protein RhiirB3_521862 [Rhizophagus irregularis] gb|POG83276.1| hypothetical protein GLOIN_2v1761315 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 74 Score = 136 bits (342), Expect = 1e-39 Identities = 67/74 (90%), Positives = 68/74 (91%) Frame = -2 Query: 342 MPNFAITNSTPSRGIIMTSCAALISFGIAAHYNSQRIKEGNEMPHLIPQILHRVDWRNLN 163 M NFA NSTP RGIIMTSCAALISFGIAAHYNSQRIKEGNEMP +IPQILHRVDWR LN Sbjct: 1 MLNFATINSTPPRGIIMTSCAALISFGIAAHYNSQRIKEGNEMPQIIPQILHRVDWRYLN 60 Query: 162 PSSSNKKSHIVMVV 121 PSSSNKKSHIVMVV Sbjct: 61 PSSSNKKSHIVMVV 74