BLASTX nr result
ID: Ophiopogon25_contig00049307
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00049307 (491 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKB98267.1| hypothetical protein RhiirA5_384057 [Rhizophagus ... 65 9e-10 gb|PKC54530.1| hypothetical protein RhiirA1_403567 [Rhizophagus ... 65 2e-09 >gb|PKB98267.1| hypothetical protein RhiirA5_384057 [Rhizophagus irregularis] Length = 233 Score = 65.5 bits (158), Expect = 9e-10 Identities = 37/63 (58%), Positives = 42/63 (66%), Gaps = 4/63 (6%) Frame = +2 Query: 14 PRESTKSITGENIIVLKISPNDSV---KPMIKEHWPTLQK-VDPNEIILWKTDDACQSLG 181 P +S K IT NIIVLK+SPND V KPMIKE WP L K V+P IIL K+DD+ Q Sbjct: 72 PPKSDKDITRRNIIVLKVSPNDRVDQLKPMIKERWPVLLKEVEPTGIILVKSDDSWQRFS 131 Query: 182 DHL 190 D L Sbjct: 132 DQL 134 >gb|PKC54530.1| hypothetical protein RhiirA1_403567 [Rhizophagus irregularis] Length = 305 Score = 65.5 bits (158), Expect = 2e-09 Identities = 37/63 (58%), Positives = 42/63 (66%), Gaps = 4/63 (6%) Frame = +2 Query: 14 PRESTKSITGENIIVLKISPNDSV---KPMIKEHWPTLQK-VDPNEIILWKTDDACQSLG 181 P +S K IT NIIVLK+SPND V KPMIKE WP L K V+P IIL K+DD+ Q Sbjct: 144 PPKSDKDITRRNIIVLKVSPNDRVDQLKPMIKERWPVLLKEVEPTGIILVKSDDSWQRFS 203 Query: 182 DHL 190 D L Sbjct: 204 DQL 206