BLASTX nr result
ID: Ophiopogon25_contig00049273
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00049273 (525 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK57186.1| hypothetical protein RhiirC2_397278 [Rhizophagus ... 49 1e-07 gb|EXX59901.1| hypothetical protein RirG_184840 [Rhizophagus irr... 49 2e-07 >gb|PKK57186.1| hypothetical protein RhiirC2_397278 [Rhizophagus irregularis] Length = 137 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 148 KLASASTALLDAVNARPKLTQAFRLEVKFL 237 +LASAST LL+AV RPKLTQAFRLEVKFL Sbjct: 26 ELASASTLLLNAVKVRPKLTQAFRLEVKFL 55 Score = 34.3 bits (77), Expect(2) = 1e-07 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +2 Query: 233 FYTCLDTVAWYDCYLRINSNL 295 F CLD V WYD YLRIN +L Sbjct: 61 FRICLDPVLWYDVYLRINPSL 81 >gb|EXX59901.1| hypothetical protein RirG_184840 [Rhizophagus irregularis DAOM 197198w] dbj|GBC47776.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 317 Score = 48.5 bits (114), Expect(2) = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +1 Query: 151 LASASTALLDAVNARPKLTQAFRLEVKFL 237 LA AST LL AV ARPKLTQAFRLEVKFL Sbjct: 26 LAKASTLLLSAVEARPKLTQAFRLEVKFL 54 Score = 33.9 bits (76), Expect(2) = 2e-07 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 Query: 233 FYTCLDTVAWYDCYLRINSNL 295 F CLD V WYD YLR+N L Sbjct: 60 FQICLDPVLWYDVYLRVNPRL 80