BLASTX nr result
ID: Ophiopogon25_contig00049241
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00049241 (499 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX50962.1| hypothetical protein RirG_265900 [Rhizophagus irr... 141 4e-41 gb|PKY43452.1| hypothetical protein RhiirA4_398802, partial [Rhi... 65 5e-11 gb|EXX77421.1| hypothetical protein RirG_023980 [Rhizophagus irr... 61 1e-09 gb|EXX58973.1| hypothetical protein RirG_193000 [Rhizophagus irr... 57 1e-07 >gb|EXX50962.1| hypothetical protein RirG_265900 [Rhizophagus irregularis DAOM 197198w] dbj|GBC42185.1| hypothetical protein RIR_2544100 [Rhizophagus irregularis DAOM 181602] gb|PKC69805.1| hypothetical protein RhiirA1_533190 [Rhizophagus irregularis] gb|PKK62187.1| hypothetical protein RhiirC2_759862 [Rhizophagus irregularis] gb|PKY23761.1| hypothetical protein RhiirB3_526747 [Rhizophagus irregularis] gb|PKY49976.1| hypothetical protein RhiirA4_545627 [Rhizophagus irregularis] gb|POG77523.1| hypothetical protein GLOIN_2v1547607 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 69 Score = 141 bits (356), Expect = 4e-41 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = +3 Query: 243 MISSIRNYFTVKSYQSEVSTSTIEPWERVLFNSVIAMSITLFMYTAFANFPEQNFNFHYS 422 MISSIRNYFTVK+YQSEVSTSTIEPWERVLFNSVIAMSITLFMYTAFANFPEQNFNFH+S Sbjct: 1 MISSIRNYFTVKNYQSEVSTSTIEPWERVLFNSVIAMSITLFMYTAFANFPEQNFNFHHS 60 Query: 423 IGDYHSFCL 449 IGDYHSFCL Sbjct: 61 IGDYHSFCL 69 >gb|PKY43452.1| hypothetical protein RhiirA4_398802, partial [Rhizophagus irregularis] Length = 72 Score = 65.1 bits (157), Expect = 5e-11 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 6/70 (8%) Frame = +3 Query: 234 LLKMISSIRNYFTVKSYQSEVSTS-TIEPWERVLFNSVIAMSITLFMYTAFA---NFPEQ 401 LL+M+++I NYF++ YQS++STS ++EPWE+ LFNS I + ITL YT FA N Sbjct: 1 LLRMLTTINNYFSLMKYQSDISTSKSLEPWEKALFNSCIIVGITLLAYTTFAQSNNMFLT 60 Query: 402 NF--NFHYSI 425 NF +FH S+ Sbjct: 61 NFDTDFHSSL 70 >gb|EXX77421.1| hypothetical protein RirG_023980 [Rhizophagus irregularis DAOM 197198w] dbj|GBC12048.1| hypothetical protein RIR_0099800 [Rhizophagus irregularis DAOM 181602] gb|PKC11728.1| hypothetical protein RhiirA5_353853 [Rhizophagus irregularis] gb|PKC71893.1| hypothetical protein RhiirA1_412536 [Rhizophagus irregularis] gb|PKK76096.1| hypothetical protein RhiirC2_735022 [Rhizophagus irregularis] gb|PKY14514.1| hypothetical protein RhiirB3_400408 [Rhizophagus irregularis] Length = 69 Score = 61.2 bits (147), Expect = 1e-09 Identities = 33/67 (49%), Positives = 46/67 (68%), Gaps = 6/67 (8%) Frame = +3 Query: 243 MISSIRNYFTVKSYQSEVSTS-TIEPWERVLFNSVIAMSITLFMYTAFA---NFPEQNF- 407 M+++I NYF++ YQS++STS ++EPWE+ LFNS I + ITL YT FA N NF Sbjct: 1 MLTTINNYFSLMKYQSDISTSKSLEPWEKALFNSCIIVGITLLAYTTFAQSNNMFLTNFD 60 Query: 408 -NFHYSI 425 +FH S+ Sbjct: 61 TDFHSSL 67 >gb|EXX58973.1| hypothetical protein RirG_193000 [Rhizophagus irregularis DAOM 197198w] dbj|GBC25089.1| serine palmitoyltransferase small subunit b [Rhizophagus irregularis DAOM 181602] gb|PKC14158.1| hypothetical protein RhiirA5_495591 [Rhizophagus irregularis] gb|PKC69158.1| hypothetical protein RhiirA1_377716 [Rhizophagus irregularis] gb|PKK78664.1| hypothetical protein RhiirC2_729084 [Rhizophagus irregularis] gb|PKY15826.1| hypothetical protein RhiirB3_520711 [Rhizophagus irregularis] gb|PKY41003.1| hypothetical protein RhiirA4_539271 [Rhizophagus irregularis] gb|POG75999.1| hypothetical protein GLOIN_2v1769612 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 74 Score = 56.6 bits (135), Expect = 1e-07 Identities = 30/71 (42%), Positives = 43/71 (60%), Gaps = 5/71 (7%) Frame = +3 Query: 243 MISSIRNYFTVKSYQSEVSTST--IEPWERVLFNSVIAMSITLFMYTAF---ANFPEQNF 407 M+ +IRNY +K+YQ EV+T+ +EPWE+ LFNS++ + + LF YT F PEQ Sbjct: 1 MLKAIRNYLALKNYQYEVTTALYMLEPWEKALFNSIVIVFLALFTYTTFFYVFYLPEQLA 60 Query: 408 NFHYSIGDYHS 440 F + Y S Sbjct: 61 YFASRLSYYAS 71