BLASTX nr result
ID: Ophiopogon25_contig00049227
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00049227 (454 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY44184.1| hypothetical protein RhiirA4_541656 [Rhizophagus ... 58 4e-07 >gb|PKY44184.1| hypothetical protein RhiirA4_541656 [Rhizophagus irregularis] Length = 276 Score = 58.2 bits (139), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 215 IKATSGDDEGQISEQQMYPLEQSAEDHYELTR 120 I AT GDDEGQ SEQQMYPLEQSAED+YELTR Sbjct: 245 IIATIGDDEGQTSEQQMYPLEQSAEDNYELTR 276