BLASTX nr result
ID: Ophiopogon25_contig00049219
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00049219 (666 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC40161.1| Tis13_94769, partial [Rhizophagus irregularis DA... 59 1e-07 >dbj|GBC40161.1| Tis13_94769, partial [Rhizophagus irregularis DAOM 181602] Length = 133 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +3 Query: 393 ILDLRYLSLYQRAFYMLDILTDAMRIFLIKIVEKGI 500 +++LR+LSLY+RAFYMLDIL DAMRIFLIKIVEK + Sbjct: 55 MINLRHLSLYRRAFYMLDILIDAMRIFLIKIVEKDL 90