BLASTX nr result
ID: Ophiopogon25_contig00049211
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00049211 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY50125.1| hypothetical protein RhiirA4_466430 [Rhizophagus ... 109 2e-25 gb|EXX51686.1| hypothetical protein RirG_259590 [Rhizophagus irr... 109 2e-25 gb|PKK80465.1| hypothetical protein RhiirC2_724328 [Rhizophagus ... 106 3e-24 >gb|PKY50125.1| hypothetical protein RhiirA4_466430 [Rhizophagus irregularis] Length = 470 Score = 109 bits (273), Expect = 2e-25 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -1 Query: 421 KLIAINSDYFLTNPPDCGINYKDDFILDVTSSRSELMNEGNQRLLNLITHW 269 KLIAINSDYFLTNPPDCGINYKDDFILDVTSSRSELMNEGNQRLLNLITHW Sbjct: 420 KLIAINSDYFLTNPPDCGINYKDDFILDVTSSRSELMNEGNQRLLNLITHW 470 >gb|EXX51686.1| hypothetical protein RirG_259590 [Rhizophagus irregularis DAOM 197198w] dbj|GBC50195.1| GDP-fucose protein o-fucosyltransferase family protein [Rhizophagus irregularis DAOM 181602] gb|PKC00185.1| hypothetical protein RhiirA5_459551 [Rhizophagus irregularis] gb|PKC70766.1| hypothetical protein RhiirA1_413964 [Rhizophagus irregularis] gb|PKY13212.1| hypothetical protein RhiirB3_398546 [Rhizophagus irregularis] gb|POG68247.1| hypothetical protein GLOIN_2v1480970 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 470 Score = 109 bits (273), Expect = 2e-25 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -1 Query: 421 KLIAINSDYFLTNPPDCGINYKDDFILDVTSSRSELMNEGNQRLLNLITHW 269 KLIAINSDYFLTNPPDCGINYKDDFILDVTSSRSELMNEGNQRLLNLITHW Sbjct: 420 KLIAINSDYFLTNPPDCGINYKDDFILDVTSSRSELMNEGNQRLLNLITHW 470 >gb|PKK80465.1| hypothetical protein RhiirC2_724328 [Rhizophagus irregularis] Length = 470 Score = 106 bits (265), Expect = 3e-24 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -1 Query: 421 KLIAINSDYFLTNPPDCGINYKDDFILDVTSSRSELMNEGNQRLLNLITHW 269 KLIAINSDYFLTNP DCGINYKDDFILDVTSSRSELMNEGNQRLLNLITHW Sbjct: 420 KLIAINSDYFLTNPSDCGINYKDDFILDVTSSRSELMNEGNQRLLNLITHW 470