BLASTX nr result
ID: Ophiopogon25_contig00049204
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00049204 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC03774.1| hypothetical protein RhiirA5_503200 [Rhizophagus ... 72 3e-13 >gb|PKC03774.1| hypothetical protein RhiirA5_503200 [Rhizophagus irregularis] Length = 154 Score = 72.4 bits (176), Expect = 3e-13 Identities = 36/38 (94%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = -1 Query: 206 MEIVKILF-VKKWETFLWGLNIAAALLNDYLYVHKIKR 96 MEIVKIL VKKWETFLWGLNIAAALLNDYLYVHKIKR Sbjct: 1 MEIVKILLSVKKWETFLWGLNIAAALLNDYLYVHKIKR 38