BLASTX nr result
ID: Ophiopogon25_contig00049185
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00049185 (1038 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY51338.1| hypothetical protein RhiirA4_468311 [Rhizophagus ... 43 5e-06 gb|EXX59516.1| hypothetical protein RirG_188320 [Rhizophagus irr... 43 5e-06 >gb|PKY51338.1| hypothetical protein RhiirA4_468311 [Rhizophagus irregularis] Length = 508 Score = 42.7 bits (99), Expect(3) = 5e-06 Identities = 24/50 (48%), Positives = 28/50 (56%), Gaps = 8/50 (16%) Frame = +3 Query: 729 DLWIIPKIVHLKIHD----SLNNFSYHQ*----IHARDEPSEFQFVDYEV 854 DLWI PK H H+ L+NF YH+ I R+EP FQ VDYEV Sbjct: 453 DLWITPKEAHSDEHNIAYQPLSNFGYHRKDCYDIELREEPGGFQIVDYEV 502 Score = 32.0 bits (71), Expect(3) = 5e-06 Identities = 23/82 (28%), Positives = 35/82 (42%) Frame = +1 Query: 478 NSNFELENSPRYLPAPKDRRSTKFSQNGFKYSQQHI***YDEQINLSFLISHFSSNDNSK 657 +SN E +SPRYLP + + + N + +FL F+ N +K Sbjct: 380 DSNIESVDSPRYLPDDDELMDMEENNN------------TSNNDSYAFLF-FFNKNGKNK 426 Query: 658 MENFSSLGTWNLVHNCCGECGP 723 M +S +HN C +CGP Sbjct: 427 MGKINSSDISYFIHN-CNDCGP 447 Score = 24.3 bits (51), Expect(3) = 5e-06 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 429 LKINIPEKIIGGYNP 473 +K I ++IIGGYNP Sbjct: 360 VKTEITDEIIGGYNP 374 >gb|EXX59516.1| hypothetical protein RirG_188320 [Rhizophagus irregularis DAOM 197198w] dbj|GBC41144.1| btb/poz domain-containing protein 19-like [Rhizophagus irregularis DAOM 181602] gb|POG80560.1| hypothetical protein GLOIN_2v1764422 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 508 Score = 42.7 bits (99), Expect(3) = 5e-06 Identities = 24/50 (48%), Positives = 28/50 (56%), Gaps = 8/50 (16%) Frame = +3 Query: 729 DLWIIPKIVHLKIHD----SLNNFSYHQ*----IHARDEPSEFQFVDYEV 854 DLWI PK H H+ L+NF YH+ I R+EP FQ VDYEV Sbjct: 453 DLWITPKEAHSDEHNIAYQPLSNFGYHRKDCYDIELREEPGGFQIVDYEV 502 Score = 32.0 bits (71), Expect(3) = 5e-06 Identities = 23/82 (28%), Positives = 35/82 (42%) Frame = +1 Query: 478 NSNFELENSPRYLPAPKDRRSTKFSQNGFKYSQQHI***YDEQINLSFLISHFSSNDNSK 657 +SN E +SPRYLP + + + N + +FL F+ N +K Sbjct: 380 DSNIESVDSPRYLPDDDELMDMEENNN------------TSNNDSYAFLF-FFNKNGKNK 426 Query: 658 MENFSSLGTWNLVHNCCGECGP 723 M +S +HN C +CGP Sbjct: 427 MGKINSSDISYFIHN-CNDCGP 447 Score = 24.3 bits (51), Expect(3) = 5e-06 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 429 LKINIPEKIIGGYNP 473 +K I ++IIGGYNP Sbjct: 360 VKTEITDEIIGGYNP 374