BLASTX nr result
ID: Ophiopogon25_contig00048407
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00048407 (1027 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC45574.1| hypothetical protein RIR_2813200 [Rhizophagus ir... 167 2e-48 >dbj|GBC45574.1| hypothetical protein RIR_2813200 [Rhizophagus irregularis DAOM 181602] Length = 116 Score = 167 bits (424), Expect = 2e-48 Identities = 86/119 (72%), Positives = 88/119 (73%), Gaps = 3/119 (2%) Frame = +2 Query: 560 MCVPRIKSIGASHCYGGWYGRFKKSQNLPLLHKVSFKLKK*SNKPMLHKANNQNLFFFEP 739 MC+PRIKSI ASHCYGGWYGRFKKSQNLPLLHKVSFKLKK Sbjct: 1 MCIPRIKSICASHCYGGWYGRFKKSQNLPLLHKVSFKLKK-------------------- 40 Query: 740 GNGCEIFSGFLACHMPYSCRFQGLLPVEIFAVYAKRLFVFQ---TRGRLSRFKDRRYFV 907 NGCEIFSGFLACHMPYSCRFQGLLPVEI K +FVFQ TRGRLSRFKDRRYFV Sbjct: 41 -NGCEIFSGFLACHMPYSCRFQGLLPVEILQYVQKGVFVFQRQKTRGRLSRFKDRRYFV 98