BLASTX nr result
ID: Ophiopogon25_contig00048369
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00048369 (363 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX63507.1| hypothetical protein RirG_151760 [Rhizophagus irr... 194 2e-58 dbj|GBC24031.1| ecsc family protein [Rhizophagus irregularis DAO... 156 2e-44 gb|PKY52220.1| hypothetical protein RhiirA4_408114 [Rhizophagus ... 155 6e-44 >gb|EXX63507.1| hypothetical protein RirG_151760 [Rhizophagus irregularis DAOM 197198w] Length = 385 Score = 194 bits (492), Expect = 2e-58 Identities = 98/115 (85%), Positives = 101/115 (87%) Frame = -1 Query: 363 FCXXXXXXXXXXXXXIVAKEEQEINIDASSKWGQIMSNLPADEFTDDIHIDSLTTQELAD 184 FC IVAKEEQEINIDASSKWGQIMSNLPADEFTDDI+IDSLTTQEL D Sbjct: 12 FCFIIFFLLLYLNVLIVAKEEQEINIDASSKWGQIMSNLPADEFTDDINIDSLTTQELTD 71 Query: 183 WAKGIAQKCLQGKASSVHSIDELTPPESAKSLASQMKYKNRPSHASLEEQTFYTS 19 WAKGIAQKCLQGKASSVHSIDELTPPESAKSLASQMKYKN+PSHASLEEQTFYT+ Sbjct: 72 WAKGIAQKCLQGKASSVHSIDELTPPESAKSLASQMKYKNKPSHASLEEQTFYTT 126 >dbj|GBC24031.1| ecsc family protein [Rhizophagus irregularis DAOM 181602] gb|PKC09597.1| hypothetical protein RhiirA5_356486 [Rhizophagus irregularis] gb|PKC57832.1| hypothetical protein RhiirA1_428201 [Rhizophagus irregularis] gb|PKK60084.1| hypothetical protein RhiirC2_762109 [Rhizophagus irregularis] gb|PKY31348.1| hypothetical protein RhiirB3_419471 [Rhizophagus irregularis] gb|POG74162.1| hypothetical protein GLOIN_2v1578255 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 339 Score = 156 bits (395), Expect = 2e-44 Identities = 76/80 (95%), Positives = 79/80 (98%) Frame = -1 Query: 258 MSNLPADEFTDDIHIDSLTTQELADWAKGIAQKCLQGKASSVHSIDELTPPESAKSLASQ 79 MSNLPADEFTDDI+IDSLTTQEL DWAKGIAQKCLQGKASSVHSIDELTPPESAKSLASQ Sbjct: 1 MSNLPADEFTDDINIDSLTTQELTDWAKGIAQKCLQGKASSVHSIDELTPPESAKSLASQ 60 Query: 78 MKYKNRPSHASLEEQTFYTS 19 MKYKN+PSHASLEEQTFYT+ Sbjct: 61 MKYKNKPSHASLEEQTFYTT 80 >gb|PKY52220.1| hypothetical protein RhiirA4_408114 [Rhizophagus irregularis] Length = 339 Score = 155 bits (392), Expect = 6e-44 Identities = 75/80 (93%), Positives = 79/80 (98%) Frame = -1 Query: 258 MSNLPADEFTDDIHIDSLTTQELADWAKGIAQKCLQGKASSVHSIDELTPPESAKSLASQ 79 MSNLPADEFTDDI+ID+LTTQEL DWAKGIAQKCLQGKASSVHSIDELTPPESAKSLASQ Sbjct: 1 MSNLPADEFTDDINIDNLTTQELTDWAKGIAQKCLQGKASSVHSIDELTPPESAKSLASQ 60 Query: 78 MKYKNRPSHASLEEQTFYTS 19 MKYKN+PSHASLEEQTFYT+ Sbjct: 61 MKYKNKPSHASLEEQTFYTT 80