BLASTX nr result
ID: Ophiopogon25_contig00048357
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00048357 (553 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY37646.1| hypothetical protein RhiirA4_238596 [Rhizophagus ... 70 6e-13 gb|PKY50874.1| hypothetical protein RhiirA4_467566 [Rhizophagus ... 59 7e-08 >gb|PKY37646.1| hypothetical protein RhiirA4_238596 [Rhizophagus irregularis] Length = 68 Score = 70.5 bits (171), Expect = 6e-13 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +1 Query: 316 RWNLRLTHLVLKQHTVLNPYDKLNPTIIKCIQQVPEKDI 432 R L+ THLVLKQHTVLNPYDKLNPTIIKC+QQVPEK I Sbjct: 9 RDTLQTTHLVLKQHTVLNPYDKLNPTIIKCVQQVPEKYI 47 >gb|PKY50874.1| hypothetical protein RhiirA4_467566 [Rhizophagus irregularis] Length = 116 Score = 58.5 bits (140), Expect = 7e-08 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 6/75 (8%) Frame = +1 Query: 229 KLPVNYRRLYYKEYSSLRFDVVHSKQQVERWNLRLTHLVLK-QH-----TVLNPYDKLNP 390 +L + +R YYKEYS LRFD+VHS QQ+ERWN R+T L +H + L + P Sbjct: 40 RLNTDVQRPYYKEYSRLRFDIVHSPQQIERWN-RITRSTLNLEHKKPIISHLPSGNSPRP 98 Query: 391 TIIKCIQQVPEKDIP 435 + K I VPEK +P Sbjct: 99 LVFKQIHHVPEKFLP 113