BLASTX nr result
ID: Ophiopogon25_contig00048315
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00048315 (588 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKB98753.1| hypothetical protein RhiirA5_463696 [Rhizophagus ... 39 2e-09 gb|PKY29956.1| hypothetical protein RhiirB3_446809 [Rhizophagus ... 39 2e-09 gb|PKC71058.1| hypothetical protein RhiirA1_454002 [Rhizophagus ... 39 9e-09 gb|PKC64437.1| hypothetical protein RhiirA1_462403 [Rhizophagus ... 39 3e-08 gb|PKK64579.1| hypothetical protein RhiirC2_787297 [Rhizophagus ... 39 7e-08 gb|PKY60155.1| hypothetical protein RhiirA4_483538 [Rhizophagus ... 39 9e-08 gb|POG81716.1| hypothetical protein GLOIN_2v1762956 [Rhizophagus... 36 7e-07 gb|PKC00804.1| hypothetical protein RhiirA5_382203 [Rhizophagus ... 36 7e-07 dbj|GBC42559.1| heat shock 70 kda protein 12b-like [Rhizophagus ... 57 2e-06 >gb|PKB98753.1| hypothetical protein RhiirA5_463696 [Rhizophagus irregularis] gb|PKC04045.1| hypothetical protein RhiirA5_449764 [Rhizophagus irregularis] Length = 926 Score = 38.5 bits (88), Expect(3) = 2e-09 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 290 LGLRCHHCYSYLTTSI 337 LGLRCHHCYSYL TSI Sbjct: 800 LGLRCHHCYSYLATSI 815 Score = 37.4 bits (85), Expect(3) = 2e-09 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +3 Query: 234 ENGVVLICGDAYHEECFQ 287 E+G VLICG AYHEECFQ Sbjct: 781 EHGEVLICGHAYHEECFQ 798 Score = 33.1 bits (74), Expect(3) = 2e-09 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +1 Query: 325 NYFYNSIDELTQSYSNRLH 381 +Y SIDELTQSY+NRLH Sbjct: 809 SYLATSIDELTQSYNNRLH 827 >gb|PKY29956.1| hypothetical protein RhiirB3_446809 [Rhizophagus irregularis] Length = 866 Score = 38.5 bits (88), Expect(3) = 2e-09 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 290 LGLRCHHCYSYLTTSI 337 LGLRCHHCYSYL TSI Sbjct: 724 LGLRCHHCYSYLATSI 739 Score = 37.4 bits (85), Expect(3) = 2e-09 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +3 Query: 234 ENGVVLICGDAYHEECFQ 287 E+G VLICG AYHEECFQ Sbjct: 705 EHGEVLICGHAYHEECFQ 722 Score = 33.1 bits (74), Expect(3) = 2e-09 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +1 Query: 325 NYFYNSIDELTQSYSNRLH 381 +Y SIDELTQSY+NRLH Sbjct: 733 SYLATSIDELTQSYNNRLH 751 >gb|PKC71058.1| hypothetical protein RhiirA1_454002 [Rhizophagus irregularis] Length = 869 Score = 38.5 bits (88), Expect(3) = 9e-09 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 290 LGLRCHHCYSYLTTSI 337 LGLRCHHCYSYL TSI Sbjct: 727 LGLRCHHCYSYLATSI 742 Score = 37.4 bits (85), Expect(3) = 9e-09 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +3 Query: 234 ENGVVLICGDAYHEECFQ 287 E+G VLICG AYHEECFQ Sbjct: 708 EHGEVLICGHAYHEECFQ 725 Score = 30.8 bits (68), Expect(3) = 9e-09 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +1 Query: 325 NYFYNSIDELTQSYSNRLH 381 +Y SIDELTQ Y+NRLH Sbjct: 736 SYLATSIDELTQLYNNRLH 754 >gb|PKC64437.1| hypothetical protein RhiirA1_462403 [Rhizophagus irregularis] Length = 103 Score = 39.3 bits (90), Expect(3) = 3e-08 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 234 ENGVVLICGDAYHEECFQ 287 ENG VLICG AYHEECFQ Sbjct: 25 ENGEVLICGHAYHEECFQ 42 Score = 34.3 bits (77), Expect(3) = 3e-08 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +2 Query: 290 LGLRCHHCYSYLTTSI 337 LGLRCHH YSYL TSI Sbjct: 44 LGLRCHHYYSYLATSI 59 Score = 31.6 bits (70), Expect(3) = 3e-08 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = +1 Query: 325 NYFYNSIDELTQSYSNRLH 381 +Y SIDELT+SY+NRLH Sbjct: 53 SYLATSIDELTRSYNNRLH 71 >gb|PKK64579.1| hypothetical protein RhiirC2_787297 [Rhizophagus irregularis] Length = 838 Score = 39.3 bits (90), Expect(3) = 7e-08 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 234 ENGVVLICGDAYHEECFQ 287 ENG VLICG AYHEECFQ Sbjct: 734 ENGEVLICGHAYHEECFQ 751 Score = 34.3 bits (77), Expect(3) = 7e-08 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +2 Query: 290 LGLRCHHCYSYLTTSI 337 LGLRCHH YSYL TSI Sbjct: 753 LGLRCHHYYSYLATSI 768 Score = 30.0 bits (66), Expect(3) = 7e-08 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 325 NYFYNSIDELTQSYSNRLH 381 +Y SIDELT+SY+N+LH Sbjct: 762 SYLATSIDELTRSYNNQLH 780 >gb|PKY60155.1| hypothetical protein RhiirA4_483538 [Rhizophagus irregularis] Length = 103 Score = 39.3 bits (90), Expect(3) = 9e-08 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 234 ENGVVLICGDAYHEECFQ 287 ENG VLICG AYHEECFQ Sbjct: 25 ENGEVLICGHAYHEECFQ 42 Score = 34.3 bits (77), Expect(3) = 9e-08 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +2 Query: 290 LGLRCHHCYSYLTTSI 337 LGLRCHH YSYL TSI Sbjct: 44 LGLRCHHYYSYLATSI 59 Score = 30.0 bits (66), Expect(3) = 9e-08 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 325 NYFYNSIDELTQSYSNRLH 381 +Y SIDELT+SY+N+LH Sbjct: 53 SYLATSIDELTRSYNNQLH 71 >gb|POG81716.1| hypothetical protein GLOIN_2v1762956 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 98 Score = 36.2 bits (82), Expect(3) = 7e-07 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 234 ENGVVLICGDAYHEECFQ 287 ENG VLICG AYHEEC Q Sbjct: 25 ENGEVLICGHAYHEECCQ 42 Score = 34.3 bits (77), Expect(3) = 7e-07 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +2 Query: 290 LGLRCHHCYSYLTTSI 337 LGLRCHH YSYL TSI Sbjct: 44 LGLRCHHYYSYLATSI 59 Score = 30.0 bits (66), Expect(3) = 7e-07 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 325 NYFYNSIDELTQSYSNRLH 381 +Y SIDELT+SY+N+LH Sbjct: 53 SYLATSIDELTRSYNNQLH 71 >gb|PKC00804.1| hypothetical protein RhiirA5_382203 [Rhizophagus irregularis] gb|PKY20658.1| hypothetical protein RhiirB3_434016 [Rhizophagus irregularis] Length = 103 Score = 36.2 bits (82), Expect(3) = 7e-07 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 234 ENGVVLICGDAYHEECFQ 287 ENG VLICG AYHEEC Q Sbjct: 25 ENGEVLICGHAYHEECCQ 42 Score = 34.3 bits (77), Expect(3) = 7e-07 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +2 Query: 290 LGLRCHHCYSYLTTSI 337 LGLRCHH YSYL TSI Sbjct: 44 LGLRCHHYYSYLATSI 59 Score = 30.0 bits (66), Expect(3) = 7e-07 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 325 NYFYNSIDELTQSYSNRLH 381 +Y SIDELT+SY+N+LH Sbjct: 53 SYLATSIDELTRSYNNQLH 71 >dbj|GBC42559.1| heat shock 70 kda protein 12b-like [Rhizophagus irregularis DAOM 181602] Length = 205 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +3 Query: 378 AYSQPTYLKEDVKKRDLREGLI*RRP*QKEDRPKGRRKEKVPKR 509 ++SQPTYLKEDVKKR LRE LI RRP Q++ RPK K+K K+ Sbjct: 161 SHSQPTYLKEDVKKRGLREDLIKRRPRQRKGRPKKETKKKEDKK 204