BLASTX nr result
ID: Ophiopogon25_contig00048305
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00048305 (623 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX57635.1| hypothetical protein RirG_205390 [Rhizophagus irr... 74 8e-13 >gb|EXX57635.1| hypothetical protein RirG_205390 [Rhizophagus irregularis DAOM 197198w] gb|PKC68721.1| hypothetical protein RhiirA1_533977 [Rhizophagus irregularis] gb|PKY27847.1| hypothetical protein RhiirB3_529481 [Rhizophagus irregularis] gb|POG64292.1| hypothetical protein GLOIN_2v1783073 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 200 Score = 74.3 bits (181), Expect = 8e-13 Identities = 43/59 (72%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -1 Query: 473 VVTEFPSSKRMLDESHSSDNDETCRKKREYKSKVKIQLFM--SSPVESEEIKNKNTEDL 303 V TEFPSSKRMLDESHS DNDET +KIQLFM SSPVESEEIKNKNT DL Sbjct: 34 VATEFPSSKRMLDESHSPDNDETL---------MKIQLFMSQSSPVESEEIKNKNTGDL 83