BLASTX nr result
ID: Ophiopogon25_contig00048206
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00048206 (584 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX57480.1| hypothetical protein RirG_206720 [Rhizophagus irr... 102 3e-25 >gb|EXX57480.1| hypothetical protein RirG_206720 [Rhizophagus irregularis DAOM 197198w] dbj|GBC25947.1| JEMT01027363.1_cds_EXX57480.1_22545 [Rhizophagus irregularis DAOM 181602] gb|PKC66143.1| hypothetical protein RhiirA1_419709 [Rhizophagus irregularis] gb|PKY49106.1| hypothetical protein RhiirA4_239933 [Rhizophagus irregularis] Length = 83 Score = 102 bits (255), Expect = 3e-25 Identities = 47/66 (71%), Positives = 50/66 (75%) Frame = +3 Query: 273 NHHIVDISTSANTSCLVELGPWERTXXXXXXXXXXXXXFYAAWDPRIEGDLFATKLIEYN 452 NHHIVDISTSA+TSCLVELGPWERT YAAWDPR+EGDL A KLIE+N Sbjct: 18 NHHIVDISTSASTSCLVELGPWERTLIHSLIALSLALVVYAAWDPRVEGDLLAVKLIEHN 77 Query: 453 YNPVHY 470 YNPVHY Sbjct: 78 YNPVHY 83