BLASTX nr result
ID: Ophiopogon25_contig00047410
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00047410 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC74237.1| hypothetical protein RhiirA1_529749 [Rhizophagus ... 64 4e-09 >gb|PKC74237.1| hypothetical protein RhiirA1_529749 [Rhizophagus irregularis] Length = 294 Score = 63.9 bits (154), Expect = 4e-09 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +1 Query: 127 RALSEYLTIAKYNPQTMYIILKKNSQKMGTDLWYAREQIRSE 252 RALSEYLTIAKYN Q MY + K+ SQK GTDLWYAREQI+SE Sbjct: 252 RALSEYLTIAKYNLQIMYNV-KEYSQKTGTDLWYAREQIQSE 292