BLASTX nr result
ID: Ophiopogon25_contig00047109
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00047109 (866 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG62829.1| hypothetical protein GLOIN_2v1692492 [Rhizophagus... 63 7e-10 >gb|POG62829.1| hypothetical protein GLOIN_2v1692492 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 90 Score = 63.2 bits (152), Expect(2) = 7e-10 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = -3 Query: 822 MNVPVISIISHYNLNQSFIASFKISRRLSYHCRIFYDIK 706 MNVPVISIISHYNL IASFKISRRLS HCRIF+DIK Sbjct: 1 MNVPVISIISHYNL----IASFKISRRLSCHCRIFHDIK 35 Score = 29.6 bits (65), Expect(2) = 7e-10 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 638 FFIFIRHPFDPRHYHFLL 585 FFIFIRHPFD +Y+ ++ Sbjct: 62 FFIFIRHPFDYIYYNLIV 79