BLASTX nr result
ID: Ophiopogon25_contig00046810
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00046810 (372 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY59806.1| hypothetical protein RhiirA4_482863 [Rhizophagus ... 99 1e-21 >gb|PKY59806.1| hypothetical protein RhiirA4_482863 [Rhizophagus irregularis] Length = 436 Score = 98.6 bits (244), Expect = 1e-21 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 202 DRQVAKNWNNERSRNRVYLHQPTITGENINGFVNINKNGIFASGSNIS 59 DRQVAKNWN+ERSRNRVYLHQPTITGENINGFVNINKNGIFASGS IS Sbjct: 31 DRQVAKNWNSERSRNRVYLHQPTITGENINGFVNINKNGIFASGSTIS 78