BLASTX nr result
ID: Ophiopogon25_contig00046660
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00046660 (567 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKU59957.1| hypothetical protein MA16_Dca028442 [Dendrobium c... 59 1e-08 gb|PKA61318.1| hypothetical protein AXF42_Ash006215 [Apostasia s... 53 7e-06 >gb|PKU59957.1| hypothetical protein MA16_Dca028442 [Dendrobium catenatum] Length = 56 Score = 59.3 bits (142), Expect = 1e-08 Identities = 30/54 (55%), Positives = 36/54 (66%), Gaps = 9/54 (16%) Frame = -1 Query: 405 ARPLEEV--WWPDE------VAGLLLEALPRGPVQPSGPSGCTHSPNNPGH-CP 271 ARPLEEV WW D+ + G LL+ LP+G PSGPSGCTH+P+N G CP Sbjct: 3 ARPLEEVDSWWMDQEDNNNIINGFLLQILPKGQTTPSGPSGCTHNPDNHGGICP 56 >gb|PKA61318.1| hypothetical protein AXF42_Ash006215 [Apostasia shenzhenica] Length = 94 Score = 52.8 bits (125), Expect = 7e-06 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = -1 Query: 372 EVAGLLLEALPRGPVQPSGPSGCTHSPNNPGH-CP 271 ++ G+LL++LP+GP P GPSGCTH+PNN G CP Sbjct: 58 KIMGILLQSLPKGPTTPQGPSGCTHNPNNHGGICP 92