BLASTX nr result
ID: Ophiopogon25_contig00046442
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00046442 (456 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY48428.1| hypothetical protein RhiirA4_404395 [Rhizophagus ... 116 3e-31 dbj|GBC42156.1| Tis13_337141 [Rhizophagus irregularis DAOM 18160... 116 3e-31 >gb|PKY48428.1| hypothetical protein RhiirA4_404395 [Rhizophagus irregularis] Length = 81 Score = 116 bits (291), Expect = 3e-31 Identities = 59/81 (72%), Positives = 60/81 (74%) Frame = -1 Query: 405 MFRPCSPPKXXXXXXXXXXXXXXXXXXXLGYFTYLVYMNWSSLCEFLTKSTIGEISEMLI 226 MFRPCSPPK LGY TYLVYMNWSSLCEFLTKSTI EISEMLI Sbjct: 1 MFRPCSPPKLVAYVLIVMLIISLMLSLTLGYLTYLVYMNWSSLCEFLTKSTICEISEMLI 60 Query: 225 YTENQEHVTRFIGSKAVTVYL 163 YTENQEH+TRFIGSKAVTVYL Sbjct: 61 YTENQEHITRFIGSKAVTVYL 81 >dbj|GBC42156.1| Tis13_337141 [Rhizophagus irregularis DAOM 181602] gb|PKC10672.1| hypothetical protein RhiirA5_355228 [Rhizophagus irregularis] gb|PKC73463.1| hypothetical protein RhiirA1_410507 [Rhizophagus irregularis] gb|PKK73117.1| hypothetical protein RhiirC2_741452 [Rhizophagus irregularis] gb|PKY15376.1| hypothetical protein RhiirB3_401532 [Rhizophagus irregularis] Length = 81 Score = 116 bits (291), Expect = 3e-31 Identities = 59/81 (72%), Positives = 60/81 (74%) Frame = -1 Query: 405 MFRPCSPPKXXXXXXXXXXXXXXXXXXXLGYFTYLVYMNWSSLCEFLTKSTIGEISEMLI 226 MFRPCSPPK LGY TYLVYMNWSSLCEFLTKSTI EISEMLI Sbjct: 1 MFRPCSPPKLVAYVLIVMLIISLMLSLILGYLTYLVYMNWSSLCEFLTKSTICEISEMLI 60 Query: 225 YTENQEHVTRFIGSKAVTVYL 163 YTENQEH+TRFIGSKAVTVYL Sbjct: 61 YTENQEHITRFIGSKAVTVYL 81