BLASTX nr result
ID: Ophiopogon25_contig00046242
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00046242 (476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC06098.1| hypothetical protein RhiirA5_501624 [Rhizophagus ... 77 4e-14 dbj|GBC32346.1| Tis13_342717: PROVISIONAL [Rhizophagus irregular... 55 1e-08 >gb|PKC06098.1| hypothetical protein RhiirA5_501624 [Rhizophagus irregularis] gb|PKC65773.1| hypothetical protein RhiirA1_536090 [Rhizophagus irregularis] Length = 213 Score = 76.6 bits (187), Expect = 4e-14 Identities = 47/70 (67%), Positives = 51/70 (72%), Gaps = 15/70 (21%) Frame = -2 Query: 166 NLTSPLEEQTGSISKRSNLNGTRIGNS*R----KILG*FFF-----------VERSVDGL 32 NLTSPL+EQTGSISKRSNLNGTRIGNS + K L FFF VERSVDGL Sbjct: 5 NLTSPLKEQTGSISKRSNLNGTRIGNSYQTRKEKYLVDFFFQQKQPLVSASSVERSVDGL 64 Query: 31 VKKALKEMGT 2 V+KALKE+GT Sbjct: 65 VEKALKEIGT 74 >dbj|GBC32346.1| Tis13_342717: PROVISIONAL [Rhizophagus irregularis DAOM 181602] gb|PKY21756.1| hypothetical protein RhiirB3_409813 [Rhizophagus irregularis] Length = 88 Score = 54.7 bits (130), Expect(2) = 1e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 166 NLTSPLEEQTGSISKRSNLNGTRIGNS 86 NLTSPL+EQTGSISKRSNLNGTRIGNS Sbjct: 5 NLTSPLKEQTGSISKRSNLNGTRIGNS 31 Score = 32.0 bits (71), Expect(2) = 1e-08 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 47 IGGWLSKKSLEGNGN 3 IGGWLS+KSLEGN N Sbjct: 41 IGGWLSRKSLEGNWN 55