BLASTX nr result
ID: Ophiopogon25_contig00045494
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00045494 (1000 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC16260.1| hypothetical protein RIR_0448000 [Rhizophagus ir... 63 3e-09 >dbj|GBC16260.1| hypothetical protein RIR_0448000 [Rhizophagus irregularis DAOM 181602] Length = 85 Score = 63.2 bits (152), Expect(2) = 3e-09 Identities = 29/35 (82%), Positives = 29/35 (82%), Gaps = 3/35 (8%) Frame = -1 Query: 730 SCRDCPNCHPEIQRIEL---YLLLCWVKDSTNMQQ 635 SCRDC NCHPE QRIEL YLLLCWVKDS NMQQ Sbjct: 51 SCRDCLNCHPEFQRIELIELYLLLCWVKDSINMQQ 85 Score = 27.7 bits (60), Expect(2) = 3e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 770 DIPVFDVEECLGR 732 DIP FDVE CLGR Sbjct: 35 DIPAFDVEGCLGR 47