BLASTX nr result
ID: Ophiopogon25_contig00045420
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00045420 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC17832.1| hypothetical protein RhiirA5_492641 [Rhizophagus ... 103 2e-26 gb|EXX74940.1| hypothetical protein RirG_046490 [Rhizophagus irr... 103 2e-26 gb|PKC75515.1| hypothetical protein RhiirA1_528734 [Rhizophagus ... 103 3e-26 >gb|PKC17832.1| hypothetical protein RhiirA5_492641 [Rhizophagus irregularis] gb|PKY18275.1| hypothetical protein RhiirB3_522647 [Rhizophagus irregularis] gb|PKY37449.1| hypothetical protein RhiirA4_536456 [Rhizophagus irregularis] Length = 69 Score = 103 bits (258), Expect = 2e-26 Identities = 53/69 (76%), Positives = 54/69 (78%) Frame = +3 Query: 33 MSALQIKVLPHIKRLTLERARLWAPSVIXXXXXXXXXXXXXXETVPRVRRDILSNIPILG 212 MSALQIKV PHIKRLTLERARLWAPSVI ETVPRVRRDILSNIPILG Sbjct: 1 MSALQIKVQPHIKRLTLERARLWAPSVIGFTGTLGTAALLFTETVPRVRRDILSNIPILG 60 Query: 213 NYWPQAEEK 239 NYWPQAE+K Sbjct: 61 NYWPQAEKK 69 >gb|EXX74940.1| hypothetical protein RirG_046490 [Rhizophagus irregularis DAOM 197198w] dbj|GBC50944.1| ubiquinol-cytochrome c reductase subunit 10 [Rhizophagus irregularis DAOM 181602] gb|PKK80872.1| hypothetical protein RhiirC2_841382 [Rhizophagus irregularis] gb|POG74391.1| hypothetical protein GLOIN_2v1771393 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 69 Score = 103 bits (258), Expect = 2e-26 Identities = 53/69 (76%), Positives = 54/69 (78%) Frame = +3 Query: 33 MSALQIKVLPHIKRLTLERARLWAPSVIXXXXXXXXXXXXXXETVPRVRRDILSNIPILG 212 MSALQIKV PHIKRLTLERARLWAPSVI ETVPRVRRDILSNIPILG Sbjct: 1 MSALQIKVQPHIKRLTLERARLWAPSVIGFAGTLGTAALLFTETVPRVRRDILSNIPILG 60 Query: 213 NYWPQAEEK 239 NYWPQAE+K Sbjct: 61 NYWPQAEKK 69 >gb|PKC75515.1| hypothetical protein RhiirA1_528734 [Rhizophagus irregularis] Length = 69 Score = 103 bits (257), Expect = 3e-26 Identities = 52/69 (75%), Positives = 54/69 (78%) Frame = +3 Query: 33 MSALQIKVLPHIKRLTLERARLWAPSVIXXXXXXXXXXXXXXETVPRVRRDILSNIPILG 212 MSALQIKV PHIKRLTLERARLWAPSVI ETVPRVRRDILSNIP+LG Sbjct: 1 MSALQIKVQPHIKRLTLERARLWAPSVIGFTGTLGTAALLFTETVPRVRRDILSNIPVLG 60 Query: 213 NYWPQAEEK 239 NYWPQAE+K Sbjct: 61 NYWPQAEKK 69