BLASTX nr result
ID: Ophiopogon25_contig00045380
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00045380 (477 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK78821.1| hypothetical protein RhiirC2_728724 [Rhizophagus ... 140 6e-41 >gb|PKK78821.1| hypothetical protein RhiirC2_728724 [Rhizophagus irregularis] Length = 69 Score = 140 bits (354), Expect = 6e-41 Identities = 66/69 (95%), Positives = 69/69 (100%) Frame = -2 Query: 326 MINVTKFALLVIVPLLLYNTIPSFTEMNFDFNQIMLGPKSEGVKITSFNNWVDPIPSMLV 147 MINVTKFALLVIVPLL+YNTIPSFTEMNFDFNQI+LGPKSEGVKITSFNNWVDP+PSMLV Sbjct: 1 MINVTKFALLVIVPLLIYNTIPSFTEMNFDFNQIILGPKSEGVKITSFNNWVDPMPSMLV 60 Query: 146 MLDEIGWFP 120 MLDEIGWFP Sbjct: 61 MLDEIGWFP 69