BLASTX nr result
ID: Ophiopogon25_contig00045161
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00045161 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY38657.1| ribosomal protein S5 domain 2-like protein [Rhizo... 70 8e-12 gb|EXX73579.1| Rrp45p [Rhizophagus irregularis DAOM 197198w] 69 3e-11 gb|PKY20584.1| ribosomal protein S5 domain 2-like protein [Rhizo... 69 4e-11 gb|EXX73578.1| Rrp45p [Rhizophagus irregularis DAOM 197198w] >gi... 69 4e-11 gb|ORZ17977.1| ribosomal protein S5 domain 2-type protein [Absid... 56 1e-06 emb|SAL96084.1| hypothetical protein [Absidia glauca] 56 1e-06 gb|ORX84131.1| ribosomal protein S5 domain 2-like protein [Anaer... 55 2e-06 gb|ORX77733.1| ribosomal protein S5 domain 2-like protein [Neoca... 55 2e-06 gb|OUM60406.1| hypothetical protein PIROE2DRAFT_21091 [Piromyces... 55 3e-06 ref|XP_021880966.1| ribosomal protein S5 domain 2-type protein [... 55 4e-06 gb|ORY01413.1| ribosomal protein S5 domain 2-like protein [Basid... 54 6e-06 gb|KFH64828.1| hypothetical protein MVEG_09558 [Mortierella vert... 54 7e-06 gb|OAC98593.1| hypothetical protein MUCCIDRAFT_149908 [Mucor cir... 54 9e-06 emb|CEP16392.1| hypothetical protein [Parasitella parasitica] 54 9e-06 gb|EPB86530.1| hypothetical protein HMPREF1544_06697 [Mucor circ... 54 9e-06 gb|ORX51048.1| ribosomal protein S5 domain 2-like protein [Pirom... 54 9e-06 emb|CEG78053.1| hypothetical protein RMATCC62417_12712 [Rhizopus... 53 9e-06 >gb|PKY38657.1| ribosomal protein S5 domain 2-like protein [Rhizophagus irregularis] Length = 312 Score = 70.5 bits (171), Expect = 8e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 +VLDY GNILD IF+TTRAALYNTKIPKTIIQDRGD E Sbjct: 151 IVLDYAGNILDTIFMTTRAALYNTKIPKTIIQDRGDGE 188 >gb|EXX73579.1| Rrp45p [Rhizophagus irregularis DAOM 197198w] Length = 271 Score = 68.6 bits (166), Expect = 3e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 +VLDY GNILD IF+ TRAALYNTKIPKTIIQDRGD E Sbjct: 151 IVLDYAGNILDTIFMATRAALYNTKIPKTIIQDRGDGE 188 >gb|PKY20584.1| ribosomal protein S5 domain 2-like protein [Rhizophagus irregularis] Length = 312 Score = 68.6 bits (166), Expect = 4e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 +VLDY GNILD IF+ TRAALYNTKIPKTIIQDRGD E Sbjct: 151 IVLDYAGNILDTIFMATRAALYNTKIPKTIIQDRGDGE 188 >gb|EXX73578.1| Rrp45p [Rhizophagus irregularis DAOM 197198w] dbj|GBC23522.1| 3' exosome complex component RRP42 [Rhizophagus irregularis DAOM 181602] gb|PKC16800.1| ribosomal protein S5 domain 2-like protein [Rhizophagus irregularis] gb|PKC60582.1| ribosomal protein S5 domain 2-like protein [Rhizophagus irregularis] gb|PKK62441.1| ribosomal protein S5 domain 2-like protein [Rhizophagus irregularis] gb|POG78152.1| ribosomal protein S5 domain 2-type protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 312 Score = 68.6 bits (166), Expect = 4e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 +VLDY GNILD IF+ TRAALYNTKIPKTIIQDRGD E Sbjct: 151 IVLDYAGNILDTIFMATRAALYNTKIPKTIIQDRGDGE 188 >gb|ORZ17977.1| ribosomal protein S5 domain 2-type protein [Absidia repens] Length = 303 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 +V+D GN+LD I +TTRAALYNT+IPKT IQD GD E Sbjct: 141 MVMDCAGNLLDCIVMTTRAALYNTRIPKTEIQDLGDGE 178 >emb|SAL96084.1| hypothetical protein [Absidia glauca] Length = 303 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 +V+D GN+LD I +TTRAALYNT+IPKT IQD GD E Sbjct: 141 MVMDCAGNLLDCIVMTTRAALYNTRIPKTEIQDLGDGE 178 >gb|ORX84131.1| ribosomal protein S5 domain 2-like protein [Anaeromyces robustus] Length = 311 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 LVLDY GN+LD IF+ TRAAL NT+IPKT IQD G+ + Sbjct: 157 LVLDYDGNLLDTIFLATRAALQNTRIPKTEIQDIGNGQ 194 >gb|ORX77733.1| ribosomal protein S5 domain 2-like protein [Neocallimastix californiae] Length = 311 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 LVLDY GN+LD IF+ TRAAL NT+IPKT IQD G+ + Sbjct: 157 LVLDYDGNLLDTIFLATRAALQNTRIPKTEIQDIGNGQ 194 >gb|OUM60406.1| hypothetical protein PIROE2DRAFT_21091 [Piromyces sp. E2] Length = 311 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 LVLDY GN+LD IF+ TRAAL NT+IPKT +QD G+ + Sbjct: 157 LVLDYDGNLLDTIFLATRAALQNTRIPKTEVQDIGNGQ 194 >ref|XP_021880966.1| ribosomal protein S5 domain 2-type protein [Lobosporangium transversale] gb|ORZ14834.1| ribosomal protein S5 domain 2-type protein [Lobosporangium transversale] Length = 319 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 LVLDY GN++D IF+ RAA+Y+TKIPKT +QD GD + Sbjct: 159 LVLDYGGNLMDAIFMGVRAAIYDTKIPKTEVQDLGDGQ 196 >gb|ORY01413.1| ribosomal protein S5 domain 2-like protein [Basidiobolus meristosporus CBS 931.73] Length = 301 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/37 (59%), Positives = 31/37 (83%) Frame = -3 Query: 180 VLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 +LDY+GNILD +FI TRAAL+NT++P T +QD G+ + Sbjct: 142 ILDYSGNILDALFIATRAALFNTRVPMTEVQDVGEGQ 178 >gb|KFH64828.1| hypothetical protein MVEG_09558 [Mortierella verticillata NRRL 6337] Length = 315 Score = 53.9 bits (128), Expect = 7e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 LVLDY GN++D IF+ TRAA+++T+IPKT +QD GD + Sbjct: 155 LVLDYGGNLMDAIFMGTRAAIFDTRIPKTEVQDLGDGQ 192 >gb|OAC98593.1| hypothetical protein MUCCIDRAFT_149908 [Mucor circinelloides f. lusitanicus CBS 277.49] Length = 303 Score = 53.5 bits (127), Expect = 9e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 +V+D GN+LD I +T RAALYNT+IPKT I+D GD E Sbjct: 141 MVMDAAGNLLDCIIMTARAALYNTRIPKTEIEDLGDGE 178 >emb|CEP16392.1| hypothetical protein [Parasitella parasitica] Length = 303 Score = 53.5 bits (127), Expect = 9e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 +V+D GN+LD I +T RAALYNT+IPKT I+D GD E Sbjct: 141 MVMDAAGNLLDCIIMTARAALYNTRIPKTEIEDLGDGE 178 >gb|EPB86530.1| hypothetical protein HMPREF1544_06697 [Mucor circinelloides f. circinelloides 1006PhL] Length = 303 Score = 53.5 bits (127), Expect = 9e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 +V+D GN+LD I +T RAALYNT+IPKT I+D GD E Sbjct: 141 MVMDAAGNLLDCIIMTARAALYNTRIPKTEIEDLGDGE 178 >gb|ORX51048.1| ribosomal protein S5 domain 2-like protein [Piromyces finnis] Length = 311 Score = 53.5 bits (127), Expect = 9e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 LVLDY GN+LD IF+ TRAAL NT+IPK IQD G+ + Sbjct: 157 LVLDYDGNLLDTIFLATRAALQNTRIPKVEIQDIGNGQ 194 >emb|CEG78053.1| hypothetical protein RMATCC62417_12712 [Rhizopus microsporus] Length = 197 Score = 52.8 bits (125), Expect = 9e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 183 LVLDYTGNILDIIFITTRAALYNTKIPKTIIQDRGDSE 70 +V+D GN+LD I +T RAALYNT+IPKT IQD G+ E Sbjct: 35 MVMDAAGNLLDCIVMTARAALYNTRIPKTEIQDLGEGE 72