BLASTX nr result
ID: Ophiopogon25_contig00045140
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00045140 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC19789.1| hypothetical protein: PROVISIONAL [Rhizophagus i... 60 6e-09 gb|EXX75440.1| hypothetical protein RirG_041970 [Rhizophagus irr... 59 9e-09 gb|PKK60749.1| hypothetical protein RhiirC2_792875 [Rhizophagus ... 60 2e-08 dbj|GBC44437.1| hypothetical protein RIR_2722400 [Rhizophagus ir... 61 2e-08 gb|PKK71812.1| hypothetical protein RhiirC2_408427 [Rhizophagus ... 60 2e-08 dbj|GBC18646.1| hypothetical protein RIR_0637400 [Rhizophagus ir... 58 2e-08 gb|PKY33476.1| hypothetical protein RhiirB3_420558, partial [Rhi... 60 3e-08 gb|POG57647.1| hypothetical protein GLOIN_2v1738235 [Rhizophagus... 60 3e-08 gb|PKK59358.1| hypothetical protein RhiirC2_857374 [Rhizophagus ... 58 4e-08 dbj|GBC45502.1| hypothetical protein: PROVISIONAL [Rhizophagus i... 60 4e-08 dbj|GBC19221.1| hypothetical protein: PROVISIONAL [Rhizophagus i... 60 5e-08 gb|POG59469.1| hypothetical protein GLOIN_2v1721776 [Rhizophagus... 60 5e-08 gb|POG59050.1| hypothetical protein GLOIN_2v1725482 [Rhizophagus... 60 5e-08 dbj|GBC48991.1| hypothetical protein RIR_3095700 [Rhizophagus ir... 60 5e-08 dbj|GBC49143.1| hypothetical protein: PROVISIONAL [Rhizophagus i... 60 5e-08 gb|POG75358.1| hypothetical protein GLOIN_2v1565907 [Rhizophagus... 59 7e-08 gb|PKY46682.1| hypothetical protein RhiirA4_402722 [Rhizophagus ... 56 8e-08 dbj|GBC34682.1| hypothetical protein RIR_1939000 [Rhizophagus ir... 59 8e-08 gb|PKB92792.1| hypothetical protein RhiirA5_368421, partial [Rhi... 56 9e-08 gb|POG60159.1| hypothetical protein GLOIN_2v1716296 [Rhizophagus... 58 1e-07 >dbj|GBC19789.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 137 Score = 60.1 bits (144), Expect = 6e-09 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKKRKVD+AFDPDYDYVYGIVSTG+ Sbjct: 33 MNINMNKKKRKVDDAFDPDYDYVYGIVSTGT 63 >gb|EXX75440.1| hypothetical protein RirG_041970 [Rhizophagus irregularis DAOM 197198w] dbj|GBC17157.1| hypothetical protein RIR_0514400 [Rhizophagus irregularis DAOM 181602] Length = 105 Score = 58.9 bits (141), Expect = 9e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKK+KVD+AFDPDYDYVYGIVSTG+ Sbjct: 1 MNINMNKKKKKVDDAFDPDYDYVYGIVSTGT 31 >gb|PKK60749.1| hypothetical protein RhiirC2_792875 [Rhizophagus irregularis] Length = 194 Score = 60.1 bits (144), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKKRKVD+AFDPDYDYVYGIVSTG+ Sbjct: 90 MNINMNKKKRKVDDAFDPDYDYVYGIVSTGT 120 >dbj|GBC44437.1| hypothetical protein RIR_2722400 [Rhizophagus irregularis DAOM 181602] Length = 351 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKKRKVDEAFDPDYDYVYGIVSTG+ Sbjct: 247 MNINMNKKKRKVDEAFDPDYDYVYGIVSTGT 277 >gb|PKK71812.1| hypothetical protein RhiirC2_408427 [Rhizophagus irregularis] Length = 191 Score = 59.7 bits (143), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKKRKVDEAFDPDY+YVYGIVSTG+ Sbjct: 87 MNINMNKKKRKVDEAFDPDYEYVYGIVSTGT 117 >dbj|GBC18646.1| hypothetical protein RIR_0637400 [Rhizophagus irregularis DAOM 181602] Length = 105 Score = 57.8 bits (138), Expect = 2e-08 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 ++I M+KKKRKVDEAFDPDY+YVYGIVSTG+ Sbjct: 1 MDINMNKKKRKVDEAFDPDYEYVYGIVSTGT 31 >gb|PKY33476.1| hypothetical protein RhiirB3_420558, partial [Rhizophagus irregularis] Length = 255 Score = 60.1 bits (144), Expect = 3e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKKRKVD+AFDPDYDYVYGIVSTG+ Sbjct: 194 MNINMNKKKRKVDDAFDPDYDYVYGIVSTGT 224 >gb|POG57647.1| hypothetical protein GLOIN_2v1738235 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 262 Score = 60.1 bits (144), Expect = 3e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKKRKVD+AFDPDYDYVYGIVSTG+ Sbjct: 170 MNINMNKKKRKVDDAFDPDYDYVYGIVSTGT 200 >gb|PKK59358.1| hypothetical protein RhiirC2_857374 [Rhizophagus irregularis] Length = 123 Score = 57.8 bits (138), Expect = 4e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 79 SFQINIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 S ++NI M+ KRKVDEAFDPDYDYVYGIVSTG+ Sbjct: 32 SNEMNINMNNLKRKVDEAFDPDYDYVYGIVSTGT 65 >dbj|GBC45502.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 310 Score = 60.1 bits (144), Expect = 4e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKKRKVD+AFDPDYDYVYGIVSTG+ Sbjct: 248 MNINMNKKKRKVDDAFDPDYDYVYGIVSTGT 278 >dbj|GBC19221.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 326 Score = 60.1 bits (144), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKKRKVD+AFDPDYDYVYGIVSTG+ Sbjct: 222 MNINMNKKKRKVDDAFDPDYDYVYGIVSTGT 252 >gb|POG59469.1| hypothetical protein GLOIN_2v1721776 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 340 Score = 60.1 bits (144), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKKRKVD+AFDPDYDYVYGIVSTG+ Sbjct: 236 MNINMNKKKRKVDDAFDPDYDYVYGIVSTGT 266 >gb|POG59050.1| hypothetical protein GLOIN_2v1725482 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 352 Score = 60.1 bits (144), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKKRKVD+AFDPDYDYVYGIVSTG+ Sbjct: 248 MNINMNKKKRKVDDAFDPDYDYVYGIVSTGT 278 >dbj|GBC48991.1| hypothetical protein RIR_3095700 [Rhizophagus irregularis DAOM 181602] Length = 352 Score = 60.1 bits (144), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKKRKVD+AFDPDYDYVYGIVSTG+ Sbjct: 248 MNINMNKKKRKVDDAFDPDYDYVYGIVSTGT 278 >dbj|GBC49143.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 354 Score = 60.1 bits (144), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKKRKVD+AFDPDYDYVYGIVSTG+ Sbjct: 250 MNINMNKKKRKVDDAFDPDYDYVYGIVSTGT 280 >gb|POG75358.1| hypothetical protein GLOIN_2v1565907 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 233 Score = 58.9 bits (141), Expect = 7e-08 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKK+KVD+AFDPDYDYVYGIVSTG+ Sbjct: 129 MNINMNKKKKKVDDAFDPDYDYVYGIVSTGT 159 >gb|PKY46682.1| hypothetical protein RhiirA4_402722 [Rhizophagus irregularis] Length = 81 Score = 55.8 bits (133), Expect = 8e-08 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +1 Query: 100 MSKKKRKVDEAFDPDYDYVYGIVSTGS 180 M+KKKRKVD+AFDPDYDYVYGIVSTG+ Sbjct: 1 MNKKKRKVDDAFDPDYDYVYGIVSTGT 27 >dbj|GBC34682.1| hypothetical protein RIR_1939000 [Rhizophagus irregularis DAOM 181602] Length = 215 Score = 58.5 bits (140), Expect = 8e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M+KKKRKVD+ FDPDYDYVYGIVSTG+ Sbjct: 111 MNINMNKKKRKVDDVFDPDYDYVYGIVSTGT 141 >gb|PKB92792.1| hypothetical protein RhiirA5_368421, partial [Rhizophagus irregularis] gb|PKB96283.1| hypothetical protein RhiirA5_367802, partial [Rhizophagus irregularis] Length = 86 Score = 55.8 bits (133), Expect = 9e-08 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +1 Query: 100 MSKKKRKVDEAFDPDYDYVYGIVSTGS 180 M+KKKRKVD+AFDPDYDYVYGIVSTG+ Sbjct: 1 MNKKKRKVDDAFDPDYDYVYGIVSTGT 27 >gb|POG60159.1| hypothetical protein GLOIN_2v1716296 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 194 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 88 INIKMSKKKRKVDEAFDPDYDYVYGIVSTGS 180 +NI M KKKRKVD+ FDPDYDYVYGIVSTG+ Sbjct: 90 MNINMKKKKRKVDDEFDPDYDYVYGIVSTGT 120