BLASTX nr result
ID: Ophiopogon25_contig00045091
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00045091 (615 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC44719.1| hypothetical protein RIR_2744200 [Rhizophagus ir... 65 2e-10 >dbj|GBC44719.1| hypothetical protein RIR_2744200 [Rhizophagus irregularis DAOM 181602] Length = 83 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -2 Query: 614 KFVNFLFYQLLKHFGKLKMIT-MDQVVSYAKESWECTKTLFG 492 KF NFLFYQLLKHFGKLKM M+Q++SYA + W C KT+FG Sbjct: 19 KFANFLFYQLLKHFGKLKMNNRMNQLISYANDMWNCVKTIFG 60