BLASTX nr result
ID: Ophiopogon25_contig00045067
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00045067 (629 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK68327.1| uncharacterized protein A4U43_C05F10260 [Asparagu... 68 7e-10 >gb|ONK68327.1| uncharacterized protein A4U43_C05F10260 [Asparagus officinalis] Length = 299 Score = 67.8 bits (164), Expect = 7e-10 Identities = 51/109 (46%), Positives = 59/109 (54%), Gaps = 4/109 (3%) Frame = +1 Query: 229 ALDLIQPNDIPWVDCTPMAMGFP---MARP-AVVLDGGYDVGSDFSEFMEHIARRIXXXX 396 AL LIQPNDIPW DC PM + P +AR V+ GG GSDFSEFM+ +A+ I Sbjct: 12 ALGLIQPNDIPW-DCGPMGLQIPQDSLARAVGPVVLGGNCTGSDFSEFMDLVAQHI--SN 68 Query: 397 XXXXXXXXEFSVDNTAALSTDNNNNDRHNLPPPLAQRVEYRRGGAAPAR 543 EFSVDN + +STD PPP AQ EY R AP R Sbjct: 69 MSPDSTIDEFSVDN-STISTDK------TFPPPFAQ-TEYYRPHKAPRR 109