BLASTX nr result
ID: Ophiopogon25_contig00044316
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00044316 (466 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG83058.1| hypothetical protein GLOIN_2v1492602 [Rhizophagus... 56 1e-07 >gb|POG83058.1| hypothetical protein GLOIN_2v1492602 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 69 Score = 56.2 bits (134), Expect = 1e-07 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 7/49 (14%) Frame = +2 Query: 338 QLLQRFT-------YYEFVIYLLCIYCNLLHIYYVFTMNLLYTYYVFTA 463 +LLQRFT YY F++YLL LL+ YYVFT+NLLY YY+FTA Sbjct: 11 RLLQRFTMYIYYVIYYIFIMYLLYFIMYLLYFYYVFTVNLLYIYYIFTA 59