BLASTX nr result
ID: Ophiopogon25_contig00043746
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00043746 (558 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX76552.1| hypothetical protein RirG_032210 [Rhizophagus irr... 204 8e-65 ref|XP_012758820.1| hypothetical protein SAMD00019534_013990, pa... 68 2e-11 dbj|GBC36840.1| hypothetical protein RIR_2111400 [Rhizophagus ir... 59 4e-08 >gb|EXX76552.1| hypothetical protein RirG_032210 [Rhizophagus irregularis DAOM 197198w] Length = 123 Score = 204 bits (519), Expect = 8e-65 Identities = 100/123 (81%), Positives = 111/123 (90%) Frame = +1 Query: 19 MEKVEKIEKVDGKIDVFVELCESLKRDYEETFLVMENGTISASNDNIRKVQEFLKKHNSF 198 MEKVEKIEKVDGK+DV +ELCESLKRDYEETF+V +NGTISASNDNIRKVQEF+K +NSF Sbjct: 1 MEKVEKIEKVDGKVDVLIELCESLKRDYEETFIVTDNGTISASNDNIRKVQEFIKTYNSF 60 Query: 199 FRFEGIEVNDLGLESSGHKQIKIVNKTKKEMVKLFGVANLIYIKACKLLKVQPSPSHISA 378 FRFEGIEVNDL LES+GH+QI+ VNKTKKE++KL GVAN IYIKACKLL VQPS H SA Sbjct: 61 FRFEGIEVNDLDLESAGHRQIRTVNKTKKEILKLLGVANHIYIKACKLLDVQPSAKHFSA 120 Query: 379 KFI 387 FI Sbjct: 121 TFI 123 >ref|XP_012758820.1| hypothetical protein SAMD00019534_013990, partial [Acytostelium subglobosum LB1] dbj|GAM18224.1| hypothetical protein SAMD00019534_013990, partial [Acytostelium subglobosum LB1] Length = 122 Score = 68.2 bits (165), Expect = 2e-11 Identities = 35/102 (34%), Positives = 55/102 (53%) Frame = +1 Query: 82 ESLKRDYEETFLVMENGTISASNDNIRKVQEFLKKHNSFFRFEGIEVNDLGLESSGHKQI 261 ES KRD+E F N TI N +I K F + + FR I +N L L +G +I Sbjct: 18 ESYKRDFELVFTFGANSTIICRNTDIAKFNTFFNDNEALFRTHEILINQLVLVPAGQGEI 77 Query: 262 KIVNKTKKEMVKLFGVANLIYIKACKLLKVQPSPSHISAKFI 387 ++V+ KK++ K +G+A ++YIK C+ L + P+ + I Sbjct: 78 EVVHLNKKKLQKAYGMAFVVYIKVCRYLNLVPNDRYTDCVII 119 >dbj|GBC36840.1| hypothetical protein RIR_2111400 [Rhizophagus irregularis DAOM 181602] Length = 92 Score = 58.5 bits (140), Expect = 4e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 91 KRDYEETFLVMENGTISASNDNIRKVQEFLK 183 K+DYEETF+V +NGTISASNDNIRKVQEF+K Sbjct: 48 KKDYEETFIVTDNGTISASNDNIRKVQEFIK 78