BLASTX nr result
ID: Ophiopogon25_contig00043469
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00043469 (528 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC12857.1| hypothetical protein RhiirA5_86352 [Rhizophagus i... 43 4e-06 >gb|PKC12857.1| hypothetical protein RhiirA5_86352 [Rhizophagus irregularis] gb|PKK77463.1| hypothetical protein RhiirC2_69047 [Rhizophagus irregularis] Length = 106 Score = 43.1 bits (100), Expect(2) = 4e-06 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 9/56 (16%) Frame = +1 Query: 301 GRNEYQTLGLSM---------LLREGKEITRITLLVLAIYFKHRVQIIVILVNLFK 441 GRNE + + L R ++ T I LLVLAI+FKHRV+ IVILVN ++ Sbjct: 49 GRNEISNFRMGIRIYKISFHALARRKRDHTYILLLVLAIFFKHRVRTIVILVNFYE 104 Score = 35.4 bits (80), Expect(2) = 4e-06 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +2 Query: 194 METIDAKKSGMAKVPENLRQ 253 ME IDAKKSGMAKVPE L Q Sbjct: 1 MEAIDAKKSGMAKVPEKLWQ 20