BLASTX nr result
ID: Ophiopogon25_contig00043335
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00043335 (521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC46560.1| hypothetical protein RIR_2893600 [Rhizophagus ir... 127 3e-35 >dbj|GBC46560.1| hypothetical protein RIR_2893600 [Rhizophagus irregularis DAOM 181602] Length = 95 Score = 127 bits (320), Expect = 3e-35 Identities = 62/82 (75%), Positives = 63/82 (76%) Frame = +3 Query: 81 MAXXXXXXXVLGDKNDNLSTTFADEPKPIKDTLIDPTKELCGDKEDQQHVKFGALPTIXX 260 MA VLGDK+DNLSTTFADEPKPIKDTLIDPTKELCGDKEDQQHVKFG LPTI Sbjct: 1 MATSTSSSSVLGDKHDNLSTTFADEPKPIKDTLIDPTKELCGDKEDQQHVKFGTLPTIEK 60 Query: 261 XXXXXXXXXTPYAWDDKLRPVF 326 TPYAWDDKLRPVF Sbjct: 61 KEKKVKRRRTPYAWDDKLRPVF 82