BLASTX nr result
ID: Ophiopogon25_contig00043304
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00043304 (518 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC02195.1| hypothetical protein RhiirA5_364333, partial [Rhi... 60 1e-08 gb|PKK68039.1| hypothetical protein RhiirC2_834500 [Rhizophagus ... 57 3e-07 gb|PKC54981.1| hypothetical protein RhiirA1_542691 [Rhizophagus ... 55 5e-07 >gb|PKC02195.1| hypothetical protein RhiirA5_364333, partial [Rhizophagus irregularis] gb|PKC09965.1| hypothetical protein RhiirA5_356077, partial [Rhizophagus irregularis] Length = 100 Score = 60.1 bits (144), Expect = 1e-08 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -3 Query: 318 KNKGPACEPLGQLVFKGVGTERTTFQPFRKTRETFIRDSHLTIFLV 181 +N GPACEPLGQL FKGVGT+ F F+K + TF+ + HLT+ LV Sbjct: 43 RNTGPACEPLGQLDFKGVGTKTHYFSTFQKAQGTFVWNCHLTVLLV 88 >gb|PKK68039.1| hypothetical protein RhiirC2_834500 [Rhizophagus irregularis] Length = 131 Score = 57.0 bits (136), Expect = 3e-07 Identities = 48/116 (41%), Positives = 56/116 (48%), Gaps = 9/116 (7%) Frame = -2 Query: 514 KKQKAKNEVINLRKTRCAMRKT*VTKHQTYTSSPSPY*RNLNTPEPMTFSNTSTKKTKQR 335 KKQK K E NL K KHQTYTS+PSPY R L P+ ++TS K Q Sbjct: 26 KKQKIKTEK-NLSK-----------KHQTYTSTPSPYFRRLT---PLLTTSTSKKYVSQE 70 Query: 334 --PKS-------LFQK*RSGLRTTWPVSL*RRRNRAHYFSTFQKDQGDVHTGQPSY 194 PK+ L Q G+ T + HYFSTFQK QG+VH PSY Sbjct: 71 LLPKNTGPACEPLGQLDFKGVGT-----------KMHYFSTFQKAQGNVHMELPSY 115 >gb|PKC54981.1| hypothetical protein RhiirA1_542691 [Rhizophagus irregularis] Length = 67 Score = 54.7 bits (130), Expect = 5e-07 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +2 Query: 443 YSGFSHCTASFPEVYDFVFCFLFFL 517 YSGFSHCT+SFPEVY F+FCFLFFL Sbjct: 11 YSGFSHCTSSFPEVYVFIFCFLFFL 35